Property Summary

NCBI Gene PubMed Count 22
Grant Count 25
R01 Count 17
Funding $3,359,119.68
PubMed Score 56.60
PubTator Score 22.00

Knowledge Summary

Patent (4,064)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
ependymoma 2.800 0.006
oligodendroglioma 1.500 0.027
osteosarcoma 2.431 0.000
atypical teratoid / rhabdoid tumor 1.700 0.002
glioblastoma 1.900 0.002
group 4 medulloblastoma 1.500 0.021
medulloblastoma, large-cell -2.100 0.000
limb girdle muscular dystrophy 2B -1.095 0.004
hereditary spastic paraplegia -1.381 0.022
Atopic dermatitis 1.300 0.020
primary pancreatic ductal adenocarcinoma 1.180 0.004
lung cancer -1.500 0.000
colon cancer -1.100 0.001
pediatric high grade glioma 1.100 0.047
aldosterone-producing adenoma -1.705 0.016
invasive ductal carcinoma -1.400 0.000
COPD -1.200 0.013
ovarian cancer -2.100 0.000
pancreatic cancer 1.200 0.005
dermatomyositis -1.800 0.001

Gene RIF (6)

PMID Text
27050392 circHIPK3 directly binds to miR-124 and inhibits miR-124 activity and cell cycle progression.
25630557 Analysis of these mutants revealed that HIPK1, HIPK2 and HIPK3 but not HIPK4 are capable of autophosphorylating on other tyrosines
20677014 Observational study of gene-disease association. (HuGE Navigator)
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17210646 This finding has linked three common factors, HIPK3, JNK, and c-Jun, to the cAMP signaling pathway leading to increased steroidogenic gene expression
14766760 JNK regulates the expression of HIPK3 in prostate cancer cells, which leads to increased resistance to Fas receptor-mediated apoptosis by reducing the interaction between FADD and caspase-8

AA Sequence

MASQVLVYPPYVYQTQSSAFCSVKKLKVEPSSCVFQERNYPRTYVNGRNFGNSHPPTKGSAFQTKIPFNR      1 - 70
PRGHNFSLQTSAVVLKNTAGATKVIAAQAQQAHVQAPQIGAWRNRLHFLEGPQRCGLKRKSEELDNHSSA     71 - 140
MQIVDELSILPAMLQTNMGNPVTVVTATTGSKQNCTTGEGDYQLVQHEVLCSMKNTYEVLDFLGRGTFGQ    141 - 210
VVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTENADEYNFVRAYECFQHRNHTCLVFEMLEQ    211 - 280
NLYDFLKQNKFSPLPLKVIRPILQQVATALKKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASH    281 - 350
VSKTVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGALEYDQIRYISQTQGLPGE    351 - 420
QLLNVGTKSTRFFCKETDMSHSGWRLKTLEEHEAETGMKSKEARKYIFNSLDDVAHVNTVMDLEGSDLLA    421 - 490
EKADRREFVSLLKKMLLIDADLRITPAETLNHPFVNMKHLLDFPHSNHVKSCFHIMDICKSHLNSCDTNN    491 - 560
HNKTSLLRPVASSSTATLTANFTKIGTLRSQALTTSAHSVVHHGIPLQAGTAQFGCGDAFQQTLIICPPA    561 - 630
IQGIPATHGKPTSYSIRVDNTVPLVTQAPAVQPLQIRPGVLSQTWSGRTQQMLVPAWQQVTPLAPATTTL    631 - 700
TSESVAGSHRLGDWGKMISCSNHYNSVMPQPLLTNQITLSAPQPVSVGIAHVVWPQPATTKKNKQCQNRG    701 - 770
ILVKLMEWEPGREEINAFSWSNSLQNTNIPHSAFISPKIINGKDVEEVSCIETQDNQNSEGEARNCCETS    771 - 840
IRQDSDSSVSDKQRQTIIIADSPSPAVSVITISSDTDEEETSQRHSLRECKGSLDCEACQSTLNIDRMCS    841 - 910
LSSPDSTLSTSSSGQSSPSPCKRPNSMSDEEQESSCDTVDGSPTSDSSGHDSPFAESTFVEDTHENTELV    911 - 980
SSADTETKPAVCSVVVPPVELENGLNADEHMANTDSICQPLIKGRSAPGRLNQPSAVGTRQQKLTSAFQQ    981 - 1050
QHLNFSQVQHFGSGHQEWNGNFGHRRQQAYIPTSVTSNPFTLSHGSPNHTAVHAHLAGNTHLGGQPTLLP   1051 - 1120
YPSSATLSSAAPVAHLLASPCTSRPMLQHPTYNISHPSGIVHQVPVGLNPRLLPSPTIHQTQYKPIFPPH   1121 - 1190
SYIAASPAYTGFPLSPTKLSQYPYM                                                1191 - 1215
//

Text Mined References (23)

PMID Year Title
27050392 2016 Circular RNA profiling reveals an abundant circHIPK3 that regulates cell growth by sponging multiple miRNAs.
25630557 2015 Effect of tyrosine autophosphorylation on catalytic activity and subcellular localisation of homeodomain-interacting protein kinases (HIPK).
24489884 2014 Genome-wide association study of proneness to anger.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17210646 2007 Cyclic AMP stimulates SF-1-dependent CYP11A1 expression through homeodomain-interacting protein kinase 3-mediated Jun N-terminal kinase and c-Jun phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16000324 2005 Up-regulation of the ubiquitous alternative splicing factor Tra2beta causes inclusion of a germ cell-specific exon.
More...