Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.83
PubTator Score 4.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 3.1e-07
group 3 medulloblastoma 4104 3.9e-03
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.058 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.400 3.9e-03
malignant mesothelioma 1.600 3.1e-07

Gene RIF (2)

AA Sequence

MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQ      1 - 70
ERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLS     71 - 140
SFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAE    141 - 210
MKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQN    211 - 280
QSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS    281 - 350
GSGSCQ                                                                    351 - 356
//

Text Mined References (24)

PMID Year Title