Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.83
PubTator Score 4.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 3.14571662612201E-7
group 3 medulloblastoma 2254 0.00391475513018211
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.048 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
group 3 medulloblastoma 1.400 0.004

Synonym

Accession Q9H410 B4DWT2 E1P5U9 Q5JW55 Q5JW56 Q9H8P4
Symbols KNL3
MIS13
hKNL-3
C20orf172
dJ469A13.2

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
18640974 HsMis13 phosphorylation by Aurora B is required for organizing a stable bi-oriented microtubule kinetochore attachment that is essential for faithful chromosome segregation in mitosis.

AA Sequence

MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQ      1 - 70
ERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLS     71 - 140
SFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAE    141 - 210
MKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQN    211 - 280
QSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS    281 - 350
GSGSCQ                                                                    351 - 356
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23035123 2012 Mitotic regulator SKAP forms a link between kinetochore core complex KMN and dynamic spindle microtubules.
20819937 2010 The MIS12 complex is a protein interaction hub for outer kinetochore assembly.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18640974 2008 Phosphorylation of HsMis13 by Aurora B kinase is essential for assembly of functional kinetochore.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18097444 2008 Molecular architecture of the kinetochore-microtubule interface.
More...