Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $75,189.89
PubMed Score 6.83
PubTator Score 4.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
group 3 medulloblastoma 1.400 0.004

Synonym

Accession Q9H410 B4DWT2 E1P5U9 Q5JW55 Q5JW56 Q9H8P4
Symbols KNL3
MIS13
hKNL-3
C20orf172
dJ469A13.2

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
18640974 HsMis13 phosphorylation by Aurora B is required for organizing a stable bi-oriented microtubule kinetochore attachment that is essential for faithful chromosome segregation in mitosis.

AA Sequence

MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSEERIHLGSSPKKGGNCDLSHQ      1 - 70
ERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLS     71 - 140
SFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKASDFSLEASVAE    141 - 210
MKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQN    211 - 280
QSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS    281 - 350
GSGSCQ                                                                    351 - 356
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23035123 2012 Mitotic regulator SKAP forms a link between kinetochore core complex KMN and dynamic spindle microtubules.
20819937 2010 The MIS12 complex is a protein interaction hub for outer kinetochore assembly.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18640974 2008 Phosphorylation of HsMis13 by Aurora B kinase is essential for assembly of functional kinetochore.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18097444 2008 Molecular architecture of the kinetochore-microtubule interface.
More...