Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.30
PubTator Score 12.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEASLLRRTHLCS      1 - 70
LSKSDTRLHELHRGPRSSRALRPASMDLLRPHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAG     71 - 140
LEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQVDVLYSRVCKPKRRD    141 - 210
PGPTTDPLDPKGQGAILALAGDLAYQTLPLRALDVDSGPLENVYESIRELGDPAGRSSTCGAGTPPASSC    211 - 280
PSLGRGWRPLPASLP                                                           281 - 295
//

Text Mined References (17)

PMID Year Title