Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.30
PubTator Score 12.41

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
22395814 these results establish LIME as a transmembrane adaptor protein linking TCR stimulation to IS formation and integrin activation through activation of Vav(Vav guanine nucleotide exchange factor)

AA Sequence

MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEASLLRRTHLCS      1 - 70
LSKSDTRLHELHRGPRSSRALRPASMDLLRPHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAG     71 - 140
LEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQVDVLYSRVCKPKRRD    141 - 210
PGPTTDPLDPKGQGAILALAGDLAYQTLPLRALDVDSGPLENVYESIRELGDPAGRSSTCGAGTPPASSC    211 - 280
PSLGRGWRPLPASLP                                                           281 - 295
//

Text Mined References (17)

PMID Year Title
24870542 2014 A draft map of the human proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22395814 2012 LIME mediates immunological synapse formation through activation of VAV.
17437027 2007 Novel peptide identification from tandem mass spectra using ESTs and sequence database compression.
16249387 2006 LIME acts as a transmembrane adapter mediating BCR-dependent B-cell activation.
16160011 2006 Transmembrane adaptor molecules: a new category of lymphoid-cell markers.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...