Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.10
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H3Z7
Symbols C20orf135
dJ591C20.1

Gene

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
18976975 Knockdown of abhydrolase domain containing 16B (ABHD16B) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MCVICFVKALVRVFKIYLTASYTYPFRGWPVAFRWDDVRAVGRSSSHRALTCAAAAAGVWLLRDETLGGD      1 - 70
ALGRPPRGARSQAQCLLQQLRELPGQLASYALAHSLGRWLVYPGSVSLMTRALLPLLQQGQERLVERYHG     71 - 140
RRAKLVACDGNEIDTMFMDRRQHPGSHVHGPRLVICCEGNAGFYEMGCLSAPLEAGYSVLGWNHPGFGSS    141 - 210
TGVPFPQHDANAMDVVVEYALHRLHFPPAHLVVYGWSVGGFTATWATMTYPELGALVLDATFDDLVPLAL    211 - 280
KVMPHSWKGLVVRTVREHFNLNVAEQLCCYPGPVLLLRRTQDDVVSTSGRLRPLSPGDVEGNRGNELLLR    281 - 350
LLEHRYPVVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRSYRARCEEELEGEEALGPHGP    351 - 420
AFPWLVGQGLSSRRRRRLALFLARKHLKNVEATHFSPLEPEEFQLPWRL                         421 - 469
//

Text Mined References (5)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.