Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
R01 Count 2
Funding $122,207.75
PubMed Score 21.25
PubTator Score 2.83

Knowledge Summary

Patent (2,591)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 0.000

Synonym

Accession Q9H3Y6
Symbols SRM
PTK70
C20orf148
dJ697K14.1

Gene

 Grant Application (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (3)

PMID Text
25897081 SRMS phosphorylated the C terminus of BRK, but not SRC.
23822091 The unique N-terminal region of SRMS regulates enzymatic activity and phosphorylation of its novel substrate docking protein 1.
18976975 Knockdown of src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (SRMS) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALYDFTARCGGEL      1 - 70
SVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPWYFSGVSRTQAQQLLLSPPNE     71 - 140
PGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLYLQKGRLFPGLEELLTYYKANWKLIQNPLLQ    141 - 210
PCMPQKAPRQDVWERPHSEFALGRKLGEGYFGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGL    211 - 280
RHERLIRLHAVCSGGEPVYIVTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRD    281 - 350
LAARNVLVDDGLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVF    351 - 420
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRCHP      421 - 488
//

Text Mined References (6)

PMID Year Title
25897081 2015 Protein-tyrosine Phosphatase and Kinase Specificity in Regulation of SRC and Breast Tumor Kinase.
23822091 2013 The unique N-terminal region of SRMS regulates enzymatic activity and phosphorylation of its novel substrate docking protein 1.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
7935409 1994 A novel nonreceptor tyrosine kinase, Srm: cloning and targeted disruption.