Property Summary

Ligand Count 4
NCBI Gene PubMed Count 5
PubMed Score 23.05
PubTator Score 2.83

Knowledge Summary

Patent (2,591)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 1.7e-23

Gene RIF (3)

AA Sequence

MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALYDFTARCGGEL      1 - 70
SVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPWYFSGVSRTQAQQLLLSPPNE     71 - 140
PGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLYLQKGRLFPGLEELLTYYKANWKLIQNPLLQ    141 - 210
PCMPQKAPRQDVWERPHSEFALGRKLGEGYFGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGL    211 - 280
RHERLIRLHAVCSGGEPVYIVTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRD    281 - 350
LAARNVLVDDGLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVF    351 - 420
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRCHP      421 - 488
//

Text Mined References (6)

PMID Year Title