Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.71
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Depressive Symptoms 28
Schizophrenia 1160
Disease Target Count P-value
osteosarcoma 7950 4.2e-03

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.050 4.2e-03

Gene RIF (1)

AA Sequence

MPLLPSTVGLAGLLFWAGQAVNALIMPNATPAPAQPESTAMRLLSGLEVPRYRRKRHISVRDMNALLDYH      1 - 70
NHIRASVYPPAANMEYMVWDKRLARAAEAWATQCIWAHGPSQLMRYVGQNLSIHSGQYRSVVDLMKSWSE     71 - 140
EKWHYLFPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNYAIK    141 - 210
GNWIGESPYKMGKPCSSCPPSYQGSCNSNMCFKGLKSNKFTWF                               211 - 253
//

Text Mined References (5)

PMID Year Title