Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.82
PubTator Score 17.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
25915847 L1-mediated CRC progression involves the acquisition of a stem cell-like phenotype, and that SMOC-2 elevation is necessary for L1-mediated induction of more aggressive/invasive CRC properties.
23463390 SMOC2 SNP may play a role in autoimmune thyroid disease susceptibility as a dominant polymorphism.
23317772 mutation in exon 8 of the SMOC2 gene linked to oligodontia
22964816 could not detect an association between SMOC2 gene and AMD. This study tests the candidacy of SMOC2 gene to the etiology of AMD
22152679 Homozygosity mapping and candidate prioritization identify mutations, missed by whole-exome sequencing, in SMOC2, causing major dental developmental defects
20965805 The variant rs13208776 in SMOC2 gene does not play a major role in increasing the risk of vitiligo in Jordanian Arab patients.
20965805 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19890347 SMOC2 is a risk locus for generalized vitiligo and perhaps other autoimmune diseases
19890347 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAK      1 - 70
CKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRP     71 - 140
ISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNK    141 - 210
NSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPK    211 - 280
CDNTARAHPAKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEER    281 - 350
VVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDG    351 - 420
KADTKKRHTPRGHAESTSNRQPRKQG                                                421 - 446
//

Text Mined References (17)

PMID Year Title
25915847 2016 Induction of the intestinal stem cell signature gene SMOC-2 is required for L1-mediated colon cancer progression.
23463390 2013 Variants in PTPN22 and SMOC2 genes and the risk of thyroid disease in the Jordanian Arab population.
23317772 2013 Recessive oligodontia linked to a homozygous loss-of-function mutation in the SMOC2 gene.
22964816 2012 Lack of association between SMOC2 polymorphism and age-related macular degeneration in Jordanian Arabs.
22152679 2011 Homozygosity mapping and candidate prioritization identify mutations, missed by whole-exome sequencing, in SMOC2, causing major dental developmental defects.
20965805 SMOC2 gene variant and the risk of vitiligo in Jordanian Arabs.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19890347 2010 Genome-wide association study of generalized vitiligo in an isolated European founder population identifies SMOC2, in close proximity to IDDM8.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17204727 2007 Secreted modular calcium-binding protein 2 haplotypes are associated with pulmonary function.
More...