| Tbio | SPARC-related modular calcium-binding protein 2 |
Promotes matrix assembly and cell adhesiveness (By similarity). Can stimulate endothelial cell proliferation, migration, as well as angiogenesis.
This gene encodes a member of the SPARC family (secreted protein acidic and rich in cysteine/osteonectin/BM-40), which are highly expressed during embryogenesis and wound healing. The gene product is a matricellular protein which promotes matrix assembly and can stimulate endothelial cell proliferation and migration, as well as angiogenic activity. Associated with pulmonary function, this secretory gene product contains a Kazal domain, two thymoglobulin type-1 domains, and two EF-hand calcium-binding domains. The encoded protein may serve as a target for controlling angiogenesis in tumor growth and myocardial ischemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
This gene encodes a member of the SPARC family (secreted protein acidic and rich in cysteine/osteonectin/BM-40), which are highly expressed during embryogenesis and wound healing. The gene product is a matricellular protein which promotes matrix assembly and can stimulate endothelial cell proliferation and migration, as well as angiogenic activity. Associated with pulmonary function, this secretory gene product contains a Kazal domain, two thymoglobulin type-1 domains, and two EF-hand calcium-binding domains. The encoded protein may serve as a target for controlling angiogenesis in tumor growth and myocardial ischemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Dentin dysplasia, type 1 | 2 | 0.0 | 0.0 |
| Liver Cirrhosis, Experimental | 769 | 0.0 | 0.0 |
| Disease | Target Count | P-value |
|---|---|---|
| lung carcinoma | 2843 | 4.7e-12 |
| ovarian cancer | 8520 | 3.1e-10 |
| Amyotrophic lateral sclerosis | 451 | 4.3e-05 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 1.4e-04 |
| invasive ductal carcinoma | 2951 | 1.6e-04 |
| intraductal papillary-mucinous adenoma (IPMA) | 2955 | 3.4e-04 |
| osteosarcoma | 7950 | 3.4e-04 |
| medulloblastoma, large-cell | 6241 | 4.6e-04 |
| cystic fibrosis | 1696 | 4.9e-04 |
| primary pancreatic ductal adenocarcinoma | 1109 | 6.4e-04 |
| pancreatic cancer | 2398 | 1.3e-03 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 1.4e-03 |
| adrenocortical carcinoma | 1428 | 1.9e-03 |
| Atopic dermatitis | 952 | 2.6e-03 |
| diabetes mellitus | 1728 | 4.2e-03 |
| sonic hedgehog group medulloblastoma | 467 | 5.0e-03 |
| active Crohn's disease | 922 | 9.1e-03 |
| Becker muscular dystrophy | 191 | 1.0e-02 |
| type II diabetes mellitus and post-ischemic heart failure | 88 | 1.3e-02 |
| spina bifida | 1074 | 2.4e-02 |
| facioscapulohumeral dystrophy | 288 | 4.5e-02 |
| Breast cancer | 3578 | 4.8e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Dentin dysplasia | 19 | 4.219 | 2.1 |
| Type 1 diabetes mellitus 8 | 6 | 3.917 | 2.0 |
| Tooth agenesis | 44 | 3.036 | 1.5 |
| Disease | Target Count |
|---|---|
| Bladder exstrophy | 32 |
| Disease | log2 FC | p |
|---|---|---|
| active Crohn's disease | 2.145 | 9.1e-03 |
| adrenocortical carcinoma | -1.848 | 1.9e-03 |
| Amyotrophic lateral sclerosis | 1.007 | 4.3e-05 |
| Atopic dermatitis | -1.100 | 2.6e-03 |
| Becker muscular dystrophy | 1.112 | 1.0e-02 |
| Breast cancer | -2.200 | 4.8e-02 |
| cystic fibrosis | 1.500 | 4.9e-04 |
| diabetes mellitus | -1.200 | 4.2e-03 |
| facioscapulohumeral dystrophy | 2.000 | 4.5e-02 |
| intraductal papillary-mucinous adenoma (... | -3.400 | 3.4e-04 |
| intraductal papillary-mucinous carcinoma... | -4.400 | 1.4e-04 |
| intraductal papillary-mucinous neoplasm ... | -4.000 | 1.4e-03 |
| invasive ductal carcinoma | -2.100 | 1.6e-04 |
| lung carcinoma | 1.600 | 4.7e-12 |
| medulloblastoma, large-cell | 1.100 | 4.6e-04 |
| osteosarcoma | 1.293 | 3.4e-04 |
| ovarian cancer | -4.300 | 3.1e-10 |
| pancreatic cancer | 1.500 | 1.3e-03 |
| primary pancreatic ductal adenocarcinoma | 1.778 | 6.4e-04 |
| sonic hedgehog group medulloblastoma | 1.600 | 5.0e-03 |
| spina bifida | -2.880 | 2.4e-02 |
| type II diabetes mellitus and post-ische... | 1.200 | 1.3e-02 |
| Species | Source | Disease |
|---|---|---|
| Inparanoid OMA | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG |
MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAK 1 - 70 CKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRP 71 - 140 ISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNK 141 - 210 NSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPK 211 - 280 CDNTARAHPAKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEER 281 - 350 VVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDG 351 - 420 KADTKKRHTPRGHAESTSNRQPRKQG 421 - 446 //
