Property Summary

NCBI Gene PubMed Count 18
PubMed Score 24.47
PubTator Score 17.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

AA Sequence

MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAK      1 - 70
CKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRP     71 - 140
ISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNK    141 - 210
NSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPK    211 - 280
CDNTARAHPAKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEER    281 - 350
VVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDG    351 - 420
KADTKKRHTPRGHAESTSNRQPRKQG                                                421 - 446
//

Text Mined References (19)

PMID Year Title