Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.34
PubTator Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.167 2.5e-05
astrocytoma 1.800 1.8e-02
Astrocytoma, Pilocytic 1.400 6.5e-09
dermatomyositis 1.500 4.9e-03
Duchenne muscular dystrophy 1.297 4.7e-07
glioblastoma 2.600 4.0e-05
invasive ductal carcinoma 1.091 3.2e-04
juvenile dermatomyositis 1.427 5.6e-10
Multiple myeloma 1.561 8.9e-04
ovarian cancer -2.400 9.3e-10
Waldenstrons macroglobulinemia 1.538 1.1e-02

Gene RIF (1)

AA Sequence

MEEEDEEARALLAGGPDEADRGAPAAPGALPALCDPSRLAHRLLVLLLMCFLGFGSYFCYDNPAALQTQV      1 - 70
KRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLME     71 - 140
FGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTT    141 - 210
LGITLMIGGITCILSLICALALAYLDQRAERILHKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAV    211 - 280
FPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAF    281 - 350
TMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFL    351 - 420
EVFFIACVSLSLLSVVLLYLVNRAQGGNLNYSARQREEIKFSHTE                             421 - 465
//

Text Mined References (6)

PMID Year Title