Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.28
PubTator Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.538 0.011
Multiple myeloma 1.561 0.001
glioblastoma 2.600 0.000
astrocytoma 1.800 0.018
Duchenne muscular dystrophy 1.297 0.000
juvenile dermatomyositis 1.427 0.000
acute quadriplegic myopathy 1.167 0.000
pilocytic astrocytoma 1.400 0.000
invasive ductal carcinoma 1.091 0.000
ovarian cancer 2.900 0.000
dermatomyositis 1.500 0.005

Gene RIF (1)

PMID Text
21752829 MFSD1 protein localizes in lysosomes in HeLa cells

AA Sequence

MEEEDEEARALLAGGPDEADRGAPAAPGALPALCDPSRLAHRLLVLLLMCFLGFGSYFCYDNPAALQTQV      1 - 70
KRDMQVNTTKFMLLYAWYSWPNVVLCFFGGFLIDRVFGIRWGTIIFSCFVCIGQVVFALGGIFNAFWLME     71 - 140
FGRFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLMGWLYSKIEALLGSAGHTT    141 - 210
LGITLMIGGITCILSLICALALAYLDQRAERILHKEQGKTGEVIKLTDVKDFSLPLWLIFIICVCYYVAV    211 - 280
FPFIGLGKVFFTEKFGFSSQAASAINSVVYVISAPMSPVFGLLVDKTGKNIIWVLCAVAATLVSHMMLAF    281 - 350
TMWNPWIAMCLLGLSYSLLACALWPMVAFVVPEHQLGTAYGFMQSIQNLGLAIISIIAGMILDSRGYLFL    351 - 420
EVFFIACVSLSLLSVVLLYLVNRAQGGNLNYSARQREEIKFSHTE                             421 - 465
//

Text Mined References (6)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
21752829 2011 Characterization of the CLEAR network reveals an integrated control of cellular clearance pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.