Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
Funding $71,244.14
PubMed Score 19.92
PubTator Score 4.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q9H3U1 A8K6F7 Q7L3Y6 Q9H3U8 Q9NSE8 Q9NSE9 Unc-45A
Symbols SMAP1
SMAP-1
GCUNC45
UNC-45A
GC-UNC45
GCUNC-45
IRO039700

Gene

PANTHER Protein Class (1)

PDB

2DBA  

Gene RIF (7)

PMID Text
26438524 UNC-45A is a crucial component in regulating human NK cell cytoskeletal dynamics via promoting the formation of actomyosin complexes.
25444911 Findings identify a novel centrosomal function for UNC45A and its role in cell proliferation and tumorigenesis.
22190034 HIV-1 IN is identified to have a physical interaction with unc-45 homolog A (C. elegans) (UNC45A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21802425 The authors found that UNC-45A is alternatively expressed at the mRNA and protein levels as two isoforms and that the two isoforms differ only by a proline-rich 15-amino-acid sequence near the amino-terminus.
18285346 GCUNC45 is required for the normal cellular distribution of Hsp90beta, but not Hsp90alpha.
17872978 elevated GC UNC-45 protein expression in ovarian carcinoma proliferation and metastasis.
16478993 GCUNC-45 is a novel modulator of progesterone receptor chaperoning by hsp90.

AA Sequence

MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLK      1 - 70
LEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQ     71 - 140
EKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVVLAREDAGAEKIFRSNGVQLLQRLLDMGETD    141 - 210
LMLAALRTLVGICSEHQSRTVATLSILGTRRVVSILGVESQAVSLAACHLLQVMFDALKEGVKKGFRGKE    211 - 280
GAIIVDPARELKVLISNLLDLLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEV    281 - 350
GGSLQDPPGELAVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSC    351 - 420
LLQGPCDAGNRALELSGVMESVIALCASEQEEEQLVAVEALIHAAGKAKRASFITANGVSLLKDLYKCSE    421 - 490
KDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQIDAGTRRWAVEGLAYLTFDADV    491 - 560
KEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSYDYEEPDPKMVELAKYAKQHVPEQHPKDKPS    561 - 630
FVRARVKKLLAAGVVSAMVCMVKTESPVLTSSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEG    631 - 700
TDVGQTKAAQALAKLTITSNPEMTFPGERIYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISERLRQK    701 - 770
ILKEKAVPMIEGYMFEEHEMIRRAATECMCNLAMSKEVQDLFEAQGNDRLKLLVLYSGEDDELLQRAAAG    771 - 840
GLAMLTSMRPTLCSRIPQVTTHWLEILQALLLSSNQELQHRGAVVVLNMVEASREIASTLMESEMMEILS    841 - 910
VLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDGE                                        911 - 944
//

Text Mined References (25)

PMID Year Title
26438524 2015 UNC-45A Is a Nonmuscle Myosin IIA Chaperone Required for NK Cell Cytotoxicity via Control of Lytic Granule Secretion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25487020 2015 UCS proteins: chaperones for myosin and co-chaperones for Hsp90.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25444911 2015 UNC45A localizes to centrosomes and regulates cancer cell proliferation through ChK1 activation.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21802425 2011 Differential turnover of myosin chaperone UNC-45A isoforms increases in metastatic human breast cancer.
21269460 2011 Initial characterization of the human central proteome.
More...