Property Summary

NCBI Gene PubMed Count 8
PubMed Score 18.25
PubTator Score 14.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 3.2e-05
ependymoma -1.400 3.3e-04
glioblastoma multiforme -1.300 4.5e-15
group 3 medulloblastoma -2.500 3.1e-03
medulloblastoma, large-cell -1.300 1.9e-03
osteosarcoma -1.230 1.7e-03
ovarian cancer -1.100 1.2e-05
primitive neuroectodermal tumor -1.200 2.7e-03
subependymal giant cell astrocytoma -1.192 1.5e-02
tuberculosis -2.600 3.0e-07
ulcerative colitis 1.452 2.8e-02

Gene RIF (3)

AA Sequence

MQTPRASPPRPALLLLLLLLGGAHGLFPEEPPPLSVAPRDYLNHYPVFVGSGPGRLTPAEGADDLNIQRV      1 - 70
LRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGECRNFVKVLLLRDEST     71 - 140
LFVCGSNAFNPVCANYSIDTLQPVGDNISGMARCPYDPKHANVALFSDGMLFTATVTDFLAIDAVIYRSL    141 - 210
GDRPTLRTVKHDSKWFKEPYFVHAVEWGSHVYFFFREIAMEFNYLEKVVVSRVARVCKNDVGGSPRVLEK    211 - 280
QWTSFLKARLNCSVPGDSHFYFNVLQAVTGVVSLGGRPVVLAVFSTPSNSIPGSAVCAFDLTQVAAVFEG    281 - 350
RFREQKSPESIWTPVPEDQVPRPRPGCCAAPGMQYNASSALPDDILNFVKTHPLMDEAVPSLGHAPWILR    351 - 420
TLMRHQLTRVAVDVGAGPWGNQTVVFLGSEAGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPG    421 - 490
GGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIGSQDPYCGWAPDGSCIFLSPGTR    491 - 560
AAFEQDVSGASTSGLGDCTGLLRASLSEDRAGLVSVNLLVTSSVAAFVVGAVVSGFSVGWFVGLRERREL    561 - 630
ARRKDKEAILAHGAGEAVLSVSRLGERRAQGPGGRGGGGGGGAGVPPEALLAPLMQNGWAKATLLQGGPH    631 - 700
DLDSGLLPTPEQTPLPQKRLPTPHPHPHALGPRAWDHGHPLLPASASSSLLLLAPARAPEQPPAPGEPTP    701 - 770
DGRLYAARPGRASHGDFPLTPHASPDRRRVVSAPTGPLDPASAADGLPRPWSPPPTGSLRRPLGPHAPPA    771 - 840
ATLRRTHTFNSGEARPGDRHRGCHARPGTDLAHLLPYGGADRTAPPVP                          841 - 888
//

Text Mined References (10)

PMID Year Title