Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
R01 Count 5
Funding $229,486.28
PubMed Score 18.17
PubTator Score 14.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma multiforme -1.300 0.000
osteosarcoma -1.230 0.002
posterior fossa group B ependymoma -2.100 0.000
group 3 medulloblastoma -2.500 0.003
medulloblastoma, large-cell -1.300 0.002
primitive neuroectodermal tumor -1.200 0.003
tuberculosis -2.600 0.000
adult high grade glioma -1.500 0.009
subependymal giant cell astrocytoma -1.192 0.015
ovarian cancer -1.100 0.000
ulcerative colitis 1.876 0.028

Synonym

Accession Q9H3T3 A5PKU4 F6IB19 Q9NRK9
Symbols SEMAN
semaZ
SEMA-VIB
SEM-SEMA-Y

Gene

Gene RIF (3)

PMID Text
23781008 Semaphorin 6B is related to tumour differentiation and metastasis in vivo, and tumour cell migration, adhesion and invasion in vitro.
23665584 states a clear relation among breast cancer and SEMA6B expression; moreover we describe for the first time the SEMA6Ba protein and report here the analysis of SEMA6Ba RNA messenger, the protein expression and the cellular localization
15177567 Gene SEMA6B is strongly down regulated by peroxisome proliferator-activated receptors.

AA Sequence

MQTPRASPPRPALLLLLLLLGGAHGLFPEEPPPLSVAPRDYLNHYPVFVGSGPGRLTPAEGADDLNIQRV      1 - 70
LRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGECRNFVKVLLLRDEST     71 - 140
LFVCGSNAFNPVCANYSIDTLQPVGDNISGMARCPYDPKHANVALFSDGMLFTATVTDFLAIDAVIYRSL    141 - 210
GDRPTLRTVKHDSKWFKEPYFVHAVEWGSHVYFFFREIAMEFNYLEKVVVSRVARVCKNDVGGSPRVLEK    211 - 280
QWTSFLKARLNCSVPGDSHFYFNVLQAVTGVVSLGGRPVVLAVFSTPSNSIPGSAVCAFDLTQVAAVFEG    281 - 350
RFREQKSPESIWTPVPEDQVPRPRPGCCAAPGMQYNASSALPDDILNFVKTHPLMDEAVPSLGHAPWILR    351 - 420
TLMRHQLTRVAVDVGAGPWGNQTVVFLGSEAGTVLKFLVRPNASTSGTSGLSVFLEEFETYRPDRCGRPG    421 - 490
GGETGQRLLSLELDAASGGLLAAFPRCVVRVPVARCQQYSGCMKNCIGSQDPYCGWAPDGSCIFLSPGTR    491 - 560
AAFEQDVSGASTSGLGDCTGLLRASLSEDRAGLVSVNLLVTSSVAAFVVGAVVSGFSVGWFVGLRERREL    561 - 630
ARRKDKEAILAHGAGEAVLSVSRLGERRAQGPGGRGGGGGGGAGVPPEALLAPLMQNGWAKATLLQGGPH    631 - 700
DLDSGLLPTPEQTPLPQKRLPTPHPHPHALGPRAWDHGHPLLPASASSSLLLLAPARAPEQPPAPGEPTP    701 - 770
DGRLYAARPGRASHGDFPLTPHASPDRRRVVSAPTGPLDPASAADGLPRPWSPPPTGSLRRPLGPHAPPA    771 - 840
ATLRRTHTFNSGEARPGDRHRGCHARPGTDLAHLLPYGGADRTAPPVP                          841 - 888
//

Text Mined References (10)

PMID Year Title
23781008 2013 The role of axon guidance factor semaphorin 6B in the invasion and metastasis of gastric cancer.
23665584 2013 Analysis of SEMA6B gene expression in breast cancer: identification of a new isoform.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15177567 2004 The human semaphorin 6B gene is down regulated by PPARs.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11350127 2001 Human semaphorin 6B [(HSA)SEMA6B], a novel human class 6 semaphorin gene: alternative splicing and all-trans-retinoic acid-dependent downregulation in glioblastoma cell lines.