Property Summary

NCBI Gene PubMed Count 9
PubMed Score 33.20
PubTator Score 8.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 7.9e-05
atypical teratoid / rhabdoid tumor 1.200 1.3e-06
Breast cancer 2.500 2.7e-02
glioblastoma 1.200 7.0e-06
hepatocellular carcinoma 1.100 2.7e-03
intraductal papillary-mucinous adenoma (... 1.200 1.0e-02
medulloblastoma, large-cell 1.200 8.0e-05
osteosarcoma 1.849 2.9e-04
primitive neuroectodermal tumor 1.200 5.1e-05

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MGSTKHWGEWLLNLKVAPAGVFGVAFLARVALVFYGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYL      1 - 70
RATYRYTPLLGWLLTPNIYLSELFGKFLFISCDLLTAFLLYRLLLLKGLGRRQACGYCVFWLLNPLPMAV     71 - 140
SSRGNADSIVASLVLMVLYLIKKRLVACAAVFYGFAVHMKIYPVTYILPITLHLLPDRDNDKSLRQFRYT    141 - 210
FQACLYELLKRLCNRAVLLFVAVAGLTFFALSFGFYYEYGWEFLEHTYFYHLTRRDIRHNFSPYFYMLYL    211 - 280
TAESKWSFSLGIAAFLPQLILLSAVSFAYYRDLVFCCFLHTSIFVTFNKVCTSQYFLWYLCLLPLVMPLV    281 - 350
RMPWKRAVVLLMLWFIGQAMWLAPAYVLEFQGKNTFLFIWLAGLFFLLINCSILIQIISHYKEEPLTERI    351 - 420
KYD                                                                       421 - 423
//

Text Mined References (9)

PMID Year Title