Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
Funding $397,126.75
PubMed Score 29.26
PubTator Score 28.32

Knowledge Summary

Patent (4,586)

Expression

  Differential Expression (17)

Disease log2 FC p
urothelial carcinoma -1.200 0.025
astrocytic glioma -1.500 0.027
ependymoma -1.700 0.027
oligodendroglioma -1.700 0.015
osteosarcoma -1.357 0.009
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.400 0.019
tuberculosis 1.900 0.000
non-small cell lung cancer -1.424 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.010
intraductal papillary-mucinous carcinoma... 1.600 0.024
lung cancer -2.800 0.000
active Crohn's disease 1.626 0.015
ulcerative colitis 2.000 0.000
subependymal giant cell astrocytoma 3.082 0.016
pterygium -1.100 0.001
ovarian cancer -1.500 0.000

Gene RIF (9)

PMID Text
23642734 These findings demonstrate that the genes involved in dictating thiamine homeostasis, such as SLC19A2, SLC25A19 and TPK-1, were significantly up-regulated in clinical tissues and breast cancer cell lines.
23333304 HIV-1 Vif upregulates the expression of thiamin pyrophosphokinase 1 (TPK1) in Vif-expression T cells
22152682 Mutation analysis of TPK1 uncovered three missense, one splice-site, and one frameshift mutation resulting in decreased TPK protein levels
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of thiamin pyrophosphokinase 1 (TPK1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17295612 Observational study of gene-disease association. (HuGE Navigator)
17295612 Genomic variations in either the fetal or maternal TPK1 gene could contribute to variability of birth weight in normal humans.
16262001 findings indicate the importance of the Sp1 transcription factor cis-element in regulating the human thiamin pyrophosphokinase gene (hTPK1) gene expression
10567383 This is the first report on the primary sequence for mammalian thiamin pyrophosphokinase, a protein that catalyzes the pyrophosphorylation of thiamin with adenosine 5'-triphosphate to form thiamin pyrophosphate.

AA Sequence

MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING      1 - 70
DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN     71 - 140
TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLA    141 - 210
FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS                                         211 - 243
//

Text Mined References (23)

PMID Year Title
23642734 2013 Up-regulation of vitamin B1 homeostasis genes in breast cancer.
22152682 2011 Thiamine pyrophosphokinase deficiency in encephalopathic children with defects in the pyruvate oxidation pathway.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17295612 2007 Three common intronic variants in the maternal and fetal thiamine pyrophosphokinase gene (TPK1) are associated with birth weight.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16262001 2005 Molecular cloning and analysis of the 5'-flanking region of the human thiamin pyrophosphokinase gene.
16087053 2005 Thiamine-responsive congenital lactic acidosis: clinical and biochemical studies.
15664409 2005 Cloning, sequencing, structural and molecular biological characterization of placental protein 20 (PP20)/human thiamin pyrophosphokinase (hTPK).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...