Property Summary

NCBI Gene PubMed Count 20
PubMed Score 69.57
PubTator Score 19.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 7.12235109236015E-9
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.81913363061605E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 8.55052578370611E-5
pancreatic cancer 2300 2.01590638858444E-4
medulloblastoma, large-cell 6234 2.48467458386525E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.35697807046937E-4
nasopharyngeal carcinoma 1056 4.65815671538042E-4
lung adenocarcinoma 2714 0.00841259004147893
esophageal adenocarcinoma 737 0.0176010007179145
active ulcerative colitis 477 0.0357101834013162
Disease Target Count Z-score Confidence
Histoplasmosis 22 3.53 1.8
Relapsing fever 16 3.518 1.8

Expression

Synonym

Accession Q9H3R2 Q6UWD9 Q9NXT5 MUC-13
Symbols DRCC1
MUC-13

Gene

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (15)

PMID Text
26323930 A combination of MUC13/MUC20 expression was a potential prognostic marker for patients with ESCC, who received neoadjuvant chemotherapy followed by surgery.
25672256 Results show that pancreatic ductal adenocarcinoma cells express higher levels of MUC13 and is associated with poor outcome when expressed at low level.
25277192 These results suggest miR-145 as a novel regulator of MUC13 in pancreatic cancer.
25261323 Based on nasopharyngeal MUC13 gene expression in readily available Nasopharyngeal aspirate samples , we can discriminate between severity of disease in Respiratory syncytial virus infected infants.
25048476 MUC13 is epigenetically regulated in ovarian cancer.
24114056 Overexpression of MUC13 is associated with pancreatic neuroendocrine tumors.
24097071 Overexpression of MUC13 increased cell growth, colony formation, cell migration, and invasion in colon cancer cells.
23708057 GALNT14 may contribute to ovarian carcinogenesis through aberrant glycosylation of MUC13.
22914648 Metastatic colon cancer and liver metastasis tissue samples demonstrated significantly (p<0.05) higher cytoplasmic and nuclear MUC13 expression compared with non-metastatic colon cancer and adjacent normal colon samples.
22027689 MUC13 overexpression caused a significant increase in cell motility, invasion, proliferation, and anchorage-dependent or -independent clonogenicity while decreasing cell-cell and cell-substratum adhesion in pancreatic cancer.
More...

AA Sequence

MKAIIHLTLLALLSVNTATNQGNSADAVTTTETATSGPTVAAADTTETNFPETASTTANTPSFPTATSPA      1 - 70
PPIISTHSSSTIPTPAPPIISTHSSSTIPIPTAADSESTTNVNSLATSDIITASSPNDGLITMVPSETQS     71 - 140
NNEMSPTTEDNQSSGPPTGTALLETSTLNSTGPSNPCQDDPCADNSLCVKLHNTSFCLCLEGYYYNSSTC    141 - 210
KKGKVFPGKISVTVSETFDPEEKHSMAYQDLHSEITSLFKDVFGTSVYGQTVILTVSTSLSPRSEMRADD    211 - 280
KFVNVTIVTILAETTSDNEKTVTEKINKAIRSSSSNFLNYDLTLRCDYYGCNQTADDCLNGLACDCKSDL    281 - 350
QRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQ    351 - 420
LILTIVGTIAGIVILSMIIALIVTARSNNKTKHIEEENLIDEDFQNLKLRSTGFTNLGAEGSVFPKVRIT    421 - 490
ASRDSQMQNPYSRHSSMPRPDY                                                    491 - 512
//

Text Mined References (21)

PMID Year Title
26323930 2015 The expression and prognostic significance of Mucin 13 and Mucin 20 in esophageal squamous cell carcinoma.
25672256 2015 A newly developed anti-Mucin 13 monoclonal antibody targets pancreatic ductal adenocarcinoma cells.
25277192 2014 MicroRNA-145 targets MUC13 and suppresses growth and invasion of pancreatic cancer.
25261323 2015 Nasopharyngeal gene expression, a novel approach to study the course of respiratory syncytial virus infection.
25048476 2014 Overexpression of mucin 13 due to promoter methylation promotes aggressive behavior in ovarian cancer cells.
24114056 2013 Overexpression of membrane proteins in primary and metastatic gastrointestinal neuroendocrine tumors.
24097071 2014 Functions and regulation of MUC13 mucin in colon cancer cells.
23708057 2013 The mucin-type glycosylating enzyme polypeptide N-acetylgalactosaminyltransferase 14 promotes the migration of ovarian cancer by modifying mucin 13.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22914648 2012 Increased expression and aberrant localization of mucin 13 in metastatic colon cancer.
More...