Property Summary

NCBI Gene PubMed Count 47
PubMed Score 43.26
PubTator Score 48.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
medulloblastoma 1524
Disease Target Count P-value
malignant mesothelioma 3163 3.29620527159147E-6
ovarian cancer 8492 2.1422167006787E-5
psoriasis 6685 2.96939367679533E-4
medulloblastoma, large-cell 6234 0.00201795317506686
glioblastoma 5572 0.00327476753580251
Disease Target Count Z-score Confidence
Obesity 616 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.383 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis 1.200 0.000
glioblastoma -1.200 0.003
medulloblastoma, large-cell -1.500 0.002
ovarian cancer -1.400 0.000

Synonym

Accession Q9H3R0 B4E1Y4 B7ZL46 F5H347 F5H7P0 O94877 Q2M3M0 Q5JUC9 Q5VYJ2 Q5VYJ3
Symbols GASC1
JHDM3C
JMJD2C
TDRD14C

Gene

PDB

2XDP   2XML   4XDO   4XDP   5FJH   5FJK   5KR7  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus OMA Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
720574 screening 140 / 86 / 95401 HTS to Identify Inhibitors of Demethylase GASC-1 Measured in Biochemical System Using Plate Reader - 2043-05_Inhibitor_SinglePoint_HTS_Activity

Gene RIF (25)

PMID Text
26766589 Pharmacological inhibition of KDM4C/PRMT1 suppresses transcription and transformation ability of MLL fusions
26747609 KDM4C recognition of H3K4me3 stimulates demethylation of H3K9me3 in cis on peptide and mononucleosome substrates.
25636512 JMJD2B and JMJD2C play an important role in the pathology of osteosarcoma via the up-regulation of FGF2.
24952432 Data suggest that D396N polymorphism of JmjC domain-containing histone demethylase JMJD2C affects the prognosis of breast cancer by altering caspase-3 cleavage and the ability of double strand DNA break repair which may contribute to therapy resistance.
24371038 GASC1 expression is higher in adenocarcinoma than squamous cell carcinoma. Smoking decreases GASC1 expression in tumor cells, indicating that tobacco smoke may influence the methylation of histone 3 lysine residues in lung cancer.
24285722 KDM4C promotes transcriptional activation by removing the repressive histone mark, H3K9me3, from its target genes. Variation in its expression leads to differences in the growth of normal and some cancer cells.
23698634 KDM4C maintains the sphere-forming capacity in CRCs by mediating the beta-catenin-dependent transcription of JAG1 in a feed-forward manner.
23692052 analysis of the nickel-induced inhibition of truncated constructs of JMJD2A and JMJD2C histone demethylases using X-ray absorption spectroscopy
23148692 Patients with GASC1 positive tumors have better breast cancer specific survival and respond better to radiotherapy and hormonal treatment
23129632 JMJD2C decreases trimethylation of histone H3 at lysine 9, and enhances HIF-1 binding to hypoxia response elements, thereby activating transcription of proteins that are required for metabolic reprogramming and for lung metastasis.
More...

AA Sequence

MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCYDDIDNLLIP      1 - 70
APIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLERKYWKNLTFVAPIYGADING     71 - 140
SIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSW    141 - 210
YAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAG    211 - 280
FNHGFNCAESTNFATVRWIDYGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTP    281 - 350
ASTPEVKAWLQRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV    351 - 420
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSISSEADDSIPL    421 - 490
SSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLEPGEIPAVPSGERNSFKVPSI    491 - 560
AEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAA    561 - 630
EQEYNATVARMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEY    631 - 700
SPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKN    701 - 770
NKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC    771 - 840
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEV    841 - 910
MFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKR    911 - 980
EDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQK    981 - 1050
KCQKRQ                                                                   1051 - 1056
//

Text Mined References (48)

PMID Year Title
26766589 2016 Targeting Aberrant Epigenetic Networks Mediated by PRMT1 and KDM4C in Acute Myeloid Leukemia.
26747609 2016 Opposing Chromatin Signals Direct and Regulate the Activity of Lysine Demethylase 4C (KDM4C).
25636512 2015 Histone demethylase JMJD2B and JMJD2C induce fibroblast growth factor 2: mediated tumorigenesis of osteosarcoma.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25014588 2014 Substrate- and cofactor-independent inhibition of histone demethylase KDM4C.
24952432 2014 A polymorphism in JMJD2C alters the cleavage by caspase-3 and the prognosis of human breast cancer.
24936217 2014 Pro-growth role of the JMJD2C histone demethylase in HCT-116 colon cancer cells and identification of curcuminoids as JMJD2 inhibitors.
24728997 2014 KDM4C (GASC1) lysine demethylase is associated with mitotic chromatin and regulates chromosome segregation during mitosis.
24396064 2014 The demethylase JMJD2C localizes to H3K4me3-positive transcription start sites and is dispensable for embryonic development.
24371038 2014 GASC1 expression in lung carcinoma is associated with smoking and prognosis of squamous cell carcinoma.
More...