Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $66,428.57
PubMed Score 3.52
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 2.500 0.010
oligodendroglioma 1.900 0.002
psoriasis -2.200 0.000
osteosarcoma -1.252 0.035
astrocytoma 2.000 0.032
glioblastoma 1.200 0.000
medulloblastoma, large-cell -1.500 0.022
adrenocortical carcinoma -1.028 0.000
lung cancer -1.100 0.002
invasive ductal carcinoma -1.791 0.000
inflammatory breast cancer -1.100 0.008

Synonym

Accession Q9H3Q1 B3KUS7 O95828 Q96FT3
Symbols CEP4
BORG4
KAIA1777

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
25981171 This study showed that CDC42EP4 messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples.

AA Sequence

MPILKQLVSSSVHSKRRSRADLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGEPDGESLDEQPS      1 - 70
SSSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQLNEKEAAEKGTSKLPKSLS     71 - 140
SSPVKKANDGEGGDEEAGTEEAVPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFH    141 - 210
IDLGPSMLGDVLSIMDKEEWDPEEGEGGYHGDEGAAGTITQAPPYAVAAPPLARQEGKAGPDLPSLPSHA    211 - 280
LEDEGWAAAAPSPGSARSMGSHTTRDSSSLSSCTSGILEERSPAFRGPDRARAAVSRQPDKEFSFMDEEE    281 - 350
EDEIRV                                                                    351 - 356
//

Text Mined References (24)

PMID Year Title
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...