Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.05
PubTator Score 3.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.028 8.7e-07
astrocytoma 1.800 3.7e-02
ependymoma 2.500 1.0e-02
glioblastoma 1.200 2.8e-04
inflammatory breast cancer -1.100 8.3e-03
invasive ductal carcinoma -1.791 1.5e-05
lung cancer -1.100 1.8e-03
medulloblastoma, large-cell -1.500 2.2e-02
oligodendroglioma 1.900 1.9e-03
osteosarcoma -1.252 3.5e-02
psoriasis -1.700 5.3e-04

Gene RIF (2)

AA Sequence

MPILKQLVSSSVHSKRRSRADLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGEPDGESLDEQPS      1 - 70
SSSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQLNEKEAAEKGTSKLPKSLS     71 - 140
SSPVKKANDGEGGDEEAGTEEAVPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFH    141 - 210
IDLGPSMLGDVLSIMDKEEWDPEEGEGGYHGDEGAAGTITQAPPYAVAAPPLARQEGKAGPDLPSLPSHA    211 - 280
LEDEGWAAAAPSPGSARSMGSHTTRDSSSLSSCTSGILEERSPAFRGPDRARAAVSRQPDKEFSFMDEEE    281 - 350
EDEIRV                                                                    351 - 356
//

Text Mined References (25)

PMID Year Title