Property Summary

NCBI Gene PubMed Count 28
PubMed Score 19.50
PubTator Score 26.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 6.67160412827153E-10
ovarian cancer 8492 7.10407906206946E-5
dermatomyositis 967 1.80421488632025E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.23511830247675E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.56867788093291E-4
Multiple myeloma 1328 0.00566994651940024
ulcerative colitis 2087 0.00784560318419727
adrenocortical carcinoma 1427 0.0137194578744139
ductal carcinoma in situ 1745 0.0203508657825612
psoriasis 6685 0.0222468504960154
Breast cancer 3099 0.0270162221104319
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.043540805250197
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 1.0

Expression

Synonym

Accession Q9H3P7 B2RB29 Q5VTJ0 Q6P9F1 Q8IZC5 Q8N4D6 Q9H6U3
Symbols PAP7
GCP60
GOCAP1
GOLPH1

Gene

PDB

2N72   2N73  

  Ortholog (11)

Gene RIF (17)

PMID Text
25940138 these findings suggest that ACBD3 has prominent impacts on cellular NAD(+) metabolism via regulating PARP1 activation-dependent auto-modification and thus cell metabolism and function.
24792752 Authors found that NS5A and PI4KB competed for association of acyl-coenzyme A binding domain containing protein 3 (ACBD3), which inhibited hepatitis C virus replication.
24672044 Host ACBD3, PI4KIIIBETA and Aichi virus proteins complexes enhances phosphatidylinositol 4-phosphate synthesis and is critical for viral replication.
24012756 ACBD3 mediates mHtt cytotoxicity via a Rhes/mHtt/ACBD3 complex.
23926333 Authors found that the Golgi protein acyl-coenzyme A binding domain-containing 3 (ACBD3), interacts with the 3A proteins of poliovaccine Sabintpe 2 and coxsackievirus A17 at viral RNA replication sites.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of acyl-CoA binding domain containing 3 (ACBD3) expression by HIV-1 Vpr in Vpr transduced macrophages
23572552 Using affinity purification-mass spectrometry, we identified the putative Rab33 GTPase-activating proteins TBC1D22A and TBC1D22B as ACBD3-interacting factors.
23166793 ACBD3 plays an essential role in maintaining lipid homeostasis via regulating SREBP1's processing pathway and thus impacting cellular lipogenesis.
22796112 identified ACBD3 as an interacting partner of PPM1L, and showed that this association, which recruits PPM1L to ER-Golgi membrane contact sites, is mediated by a GOLD (Golgi dynamics) domain in ACBD3
22383495 The data were consistent with PAP7 interacting with DMT1 and regulating DMT1 expression in K562 cells by modulating expression of DMT1 protein.
More...

AA Sequence

MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAE      1 - 70
EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGN     71 - 140
DRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKE    141 - 210
EEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL    211 - 280
QEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE    281 - 350
PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF    351 - 420
ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEE    421 - 490
VYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR                                    491 - 528
//

Text Mined References (36)

PMID Year Title
25940138 2015 Acyl-CoA-binding domain containing 3 modulates NAD+ metabolism through activating poly(ADP-ribose) polymerase 1.
24792752 2014 Hepatitis C virus NS5A competes with PI4KB for binding to ACBD3 in a genotype-dependent manner.
24672044 2014 A complex comprising phosphatidylinositol 4-kinase III?, ACBD3, and Aichi virus proteins enhances phosphatidylinositol 4-phosphate synthesis and is critical for formation of the viral replication complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24012756 2013 Golgi protein ACBD3 mediates neurotoxicity associated with Huntington's disease.
23926333 2013 The Golgi protein ACBD3, an interactor for poliovirus protein 3A, modulates poliovirus replication.
23572552 2013 ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166793 2012 Maturation and activity of sterol regulatory element binding protein 1 is inhibited by acyl-CoA binding domain containing 3.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...