Property Summary

NCBI Gene PubMed Count 30
PubMed Score 5.10
PubTator Score 11.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Wolf-Hirschhorn syndrome 32
Disease Target Count P-value
medulloblastoma 1524 1.35975647847183E-7
medulloblastoma, large-cell 6234 3.35938078397253E-6
glioblastoma 5572 3.6243836716428E-6
pilocytic astrocytoma 3086 2.97072399593516E-5
atypical teratoid / rhabdoid tumor 4369 1.28020331730343E-4
adult high grade glioma 2148 3.57978144355866E-4
lung cancer 4473 0.00240844339738863
astrocytic glioma 2241 0.0135717332281959
primitive neuroectodermal tumor 3031 0.0303610639464068
Disease Target Count Z-score Confidence
Microcephaly 149 3.547 1.8

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.600 0.014
glioblastoma -2.400 0.000
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.300 0.030
lung cancer 1.100 0.002
adult high grade glioma -2.000 0.000
pilocytic astrocytoma -1.700 0.000

Synonym

Accession Q9H3P2 A2A2T1 O95392 NELF-A
Symbols WHSC2
NELF-A
P/OKcl.15

Gene

PDB

5L3X  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (13)

PMID Text
24158816 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
24097989 These studies allow us to position the actions of two new modulators of GR-regulated transactivation, NELF-A and NELF-B, relative to other factors in the overall gene induction sequence.
23518577 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
22328085 haploinsufficiency of SLBP and/or WHSC2 (NELF-A) contributes to several novel cellular phenotypes of WHS.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19245807 data show that NELF subunits exhibit highly specific subcellular localizations, such as in NELF bodies or in midbodies, and some shuttle actively between the nucleus and cytoplasm; loss of NELF from cells can lead to enlarged and/or multiple nuclei
17499042 Negative elongation factor (NELF) is a four subunit transcription factor. Our results point to a surprising role of NELF in the 3' end processing of histone mRNAs and suggest that NELF is a new factor that coordinates mRNA processing in transcription
17442680 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
16838299 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
12715353 connection between the syndrome phenotype and cytogenetic abnormalities, through gradual shortening of the length of the critical region WHSCR (finally up to 165 kb), and sequencing it, at least 2 genes (WHSC1 and WHSC2) were identified.
More...

AA Sequence

MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGTLHLPRRTVDE      1 - 70
MKGALMEIIQLASLDSDPWVLMVADILKSFPDTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLE     71 - 140
CQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDT    141 - 210
TTPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLRKERGVKLLDISELDMVGAGREAKRRRKTLDA    211 - 280
EVVEKPAKEETVVENATPDYAAGLVSTQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSR    281 - 350
EASRPPEEPSAPSPTLPAQFKQRAPMYNSGLSPATPTPAAPTSPLTPTTPPAVAPTTQTPPVAMVAPQTQ    351 - 420
APAQQQPKKNLSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLP    421 - 490
KADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMTNVS                                    491 - 528
//

Text Mined References (37)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097989 2013 A conserved protein motif is required for full modulatory activity of negative elongation factor subunits NELF-A and NELF-B in modifying glucocorticoid receptor-regulated gene induction properties.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22328085 2012 Characterizing the functional consequences of haploinsufficiency of NELF-A (WHSC2) and SLBP identifies novel cellular phenotypes in Wolf-Hirschhorn syndrome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...