Property Summary

NCBI Gene PubMed Count 79
Grant Count 6
R01 Count 5
Funding $848,629.5
PubMed Score 254.04
PubTator Score 146.58

Knowledge Summary

Patent (21,522)

Expression

  Differential Expression (4)

Disease log2 FC p
uncontrolled asthma 1.400 0.035
osteosarcoma -1.150 0.000
medulloblastoma, large-cell 1.400 0.001
non primary Sjogren syndrome sicca -1.300 0.018

Synonym

Accession Q9H3N8 B0YJ19 B2KJ48 Q4G0I6 Q9GZQ0 H4R
Symbols H4
H4R
BG26
HH4R
AXOR35
GPRv53
GPCR105

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2

Gene RIF (69)

PMID Text
26828993 Activation of the H4R could induce phosphorylation of ERK.
26823878 Suggest roles for HRH4 polymorphisms and ankylosing spondylitis susceptibility.
25300787 Functional H4 receptors increasing (35)S-GTPgammaS binding and/or decreasing noradrenaline release are not found in human, guinea pig or mouse cortex
25293806 HRH4 was increased in clinically-isolated syndrome and different stages of multiple sclerosis compared to health control.
25273276 No evidence was found for the presence of histamine H4 receptor in monocytes.
25098339 Molecular modelling studies, including molecular dynamic simulations and calculation of Gibbs energy of solvation of hH3R and hH4R, were studied.
24934979 The activation of H4R in human mast cells produced not only inflammatory mediators that are associated with allergic reactions but also other inflammatory conditions.
24799603 In neutrophils, the H4 receptor may block signals emanating from Mac-1-controlling degranulation. Engagement of the H4 receptor by selective agonists blocked Mac-1-dependent activation of p38 MAPK.
24787705 H4 receptor expression plays a role in pathological vessel leakage associated with choroidal neovascularization
24530738 The inhibitory effects of histamine on reactive oxygen species production in whole blood phagocytes are caused by H2R rather than H4R histamine receptors.
More...

AA Sequence

MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAISDFFVGVISIP      1 - 70
LYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAVSYRTQHTGVLKIVTLMVAVW     71 - 140
VLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSFLEFVIPVILVAYFNMNIYWSLWKRDHLSRC    141 - 210
QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFS    211 - 280
QSDSVALHQREHVELLRARRLAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFN    281 - 350
SFVNPLLYPLCHKRFQKAFLKIFCIKKQPLPSQHSRSVSS                                  351 - 390
//

Text Mined References (81)

PMID Year Title
26828993 2016 Histamine H4 Receptor mediates interleukin-8 and TNF-? release in human mast cells via multiple signaling pathways.
26823878 2015 Association between HRH4 polymorphisms and ankylosing spondylitis susceptibility.
25300787 2015 A search for functional histamine H4 receptors in the human, guinea pig and mouse brain.
25293806 2014 Gene expression analysis of histamine receptors in peripheral blood mononuclear cells from individuals with clinically-isolated syndrome and different stages of multiple sclerosis.
25273276 2014 No evidence for histamine H4 receptor in human monocytes.
25098339 2014 Sodium binding to hH3R and hH 4R--a molecular modeling study.
24934979 2014 Functional characterization of histamine H4 receptor on human mast cells.
24799603 2014 The histamine H4 receptor is a potent inhibitor of adhesion-dependent degranulation in human neutrophils.
24787705 2014 Histamine H4 receptor as a new therapeutic target for choroidal neovascularization in age-related macular degeneration.
24530738 2014 Role of histamine receptors in the effects of histamine on the production of reactive oxygen species by whole blood phagocytes.
More...