Property Summary

Ligand Count 504
NCBI Gene PubMed Count 87
PubMed Score 263.64
PubTator Score 146.58

Knowledge Summary

Patent (21,522)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.400 5.1e-04
non primary Sjogren syndrome sicca -1.300 1.8e-02
osteosarcoma -1.150 3.1e-05
uncontrolled asthma 1.400 3.5e-02

Gene RIF (77)

AA Sequence

MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAISDFFVGVISIP      1 - 70
LYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAVSYRTQHTGVLKIVTLMVAVW     71 - 140
VLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSFLEFVIPVILVAYFNMNIYWSLWKRDHLSRC    141 - 210
QSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFS    211 - 280
QSDSVALHQREHVELLRARRLAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFN    281 - 350
SFVNPLLYPLCHKRFQKAFLKIFCIKKQPLPSQHSRSVSS                                  351 - 390
//

Text Mined References (89)

PMID Year Title