Property Summary

NCBI Gene PubMed Count 15
Grant Count 15
R01 Count 5
Funding $574,153.07
PubMed Score 52.36
PubTator Score 17.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.998 0.000
astrocytic glioma 1.400 0.043
psoriasis 1.200 0.001
glioblastoma 2.900 0.000
oligodendroglioma 1.200 0.000
osteosarcoma 3.231 0.000
posterior fossa group B ependymoma 2.000 0.000
group 3 medulloblastoma 1.800 0.001
atypical teratoid/rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 1.900 0.000
primitive neuroectodermal tumor 1.500 0.000
juvenile dermatomyositis 1.159 0.000
acute quadriplegic myopathy 1.582 0.000
lung cancer 1.600 0.009
Breast cancer 3.600 0.022
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 1.500 0.000
aldosterone-producing adenoma -1.290 0.046
lung adenocarcinoma 1.368 0.000
progressive supranuclear palsy -1.200 0.006
ovarian cancer -1.500 0.000
Down syndrome 1.100 0.001

Gene RIF (5)

PMID Text
26246604 Here we show that TMX1, one of the few transmembrane members of the family, forms functional complexes with the ER lectin calnexin and preferentially intervenes during maturation of cysteine-containing, membrane-associated proteins
22924822 We conclude that TMX plays a major role in host defense under the type of inflammatory conditions associated with oxidative stress.
22228764 the silencing of TMX in the prostatic cell line DU145 reduced the sensitivity of the cells to ricin intoxication further confirming a role for this enzyme in intracellular ricin activation.
22045338 TMX1 is enriched on the mitochondria-associated membrane. Targeting TMX to the MAM requires palmitoylation of two membrane-proximal cytosolic cysteines.
19741092 These results suggest a specific role for transmembrane thioredoxin-related protein TMX and its mechanism of action in redox-based ER quality control.

AA Sequence

MAPSGSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFA      1 - 70
EWGEDLEVNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSS     71 - 140
WFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSK    141 - 210
RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS    211 - 280
//

Text Mined References (29)

PMID Year Title
26246604 2015 Division of labor among oxidoreductases: TMX1 preferentially acts on transmembrane polypeptides.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22924822 2013 The protective role of the transmembrane thioredoxin-related protein TMX in inflammatory liver injury.
22228764 2012 Reductive activation of type 2 ribosome-inactivating proteins is promoted by transmembrane thioredoxin-related protein.
22045338 2012 Palmitoylated TMX and calnexin target to the mitochondria-associated membrane.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...