Property Summary

NCBI Gene PubMed Count 17
PubMed Score 58.45
PubTator Score 17.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.362 9.9e-07
adult high grade glioma 1.400 1.0e-03
aldosterone-producing adenoma -1.290 4.6e-02
astrocytic glioma 1.400 4.3e-02
Astrocytoma, Pilocytic 1.500 2.3e-06
atypical teratoid / rhabdoid tumor 1.600 2.2e-04
Breast cancer 3.600 2.2e-02
Down syndrome 1.100 5.9e-04
ependymoma 1.800 1.2e-10
glioblastoma 1.500 5.1e-06
group 3 medulloblastoma 1.800 8.3e-04
juvenile dermatomyositis 1.159 3.2e-10
lung adenocarcinoma 1.368 2.1e-05
lung cancer 1.600 8.9e-03
medulloblastoma, large-cell 1.900 8.8e-06
Multiple myeloma 1.998 3.2e-04
oligodendroglioma 1.100 1.0e-06
osteosarcoma 3.231 2.3e-04
ovarian cancer -1.500 8.8e-05
primitive neuroectodermal tumor 1.500 3.0e-04
progressive supranuclear palsy -1.200 5.6e-03
psoriasis 1.200 8.4e-04

Gene RIF (7)

AA Sequence

MAPSGSLAVPLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFA      1 - 70
EWGEDLEVNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSS     71 - 140
WFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSK    141 - 210
RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS    211 - 280
//

Text Mined References (31)

PMID Year Title