Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.65
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 2.62506145417202E-7
lung adenocarcinoma 2714 0.0383552116528876
Disease Target Count Z-score Confidence
Machado-Joseph disease 18 3.157 1.6

Synonym

Accession Q9H3M9 B2RNY8
Symbols MJDL

Gene

PANTHER Protein Class (1)

PDB

3O65  

  Ortholog (3)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
26079537 ATXN3L has a role in the regulation of KLF5 stability in breast cancer

AA Sequence

MDFIFHEKQEGFLCAQHCLNNLLQGEYFSPVELASIAHQLDEEERMRMAEGGVTSEEYLAFLQQPSENMD      1 - 70
DTGFFSIQVISNALKFWGLEIIHFNNPEYQKLGIDPINERSFICNYKQHWFTIRKFGKHWFNLNSLLAGP     71 - 140
ELISDTCLANFLARLQQQAYSVFVVKGDLPDCEADQLLQIISVEEMDTPKLNGKKLVKQKEHRVYKTVLE    141 - 210
KVSEESDESGTSDQDEEDFQRALELSRQETNREDEHLRSTIELSMQGSSGNTSQDLPKTSCVTPASEQPK    211 - 280
KIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEGTVQAAVDTILEIMRKNLK    281 - 350
IKGEK                                                                     351 - 355
//

Text Mined References (7)

PMID Year Title
26079537 2015 Ataxin-3 like (ATXN3L), a member of the Josephin family of deubiquitinating enzymes, promotes breast cancer proliferation by deubiquitinating Krüppel-like factor 5 (KLF5).
21118805 2011 Crystal structure of a Josephin-ubiquitin complex: evolutionary restraints on ataxin-3 deubiquitinating activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11450850 2001 The genomic structure and expression of MJD, the Machado-Joseph disease gene.