Property Summary

NCBI Gene PubMed Count 125
Grant Count 135
R01 Count 64
Funding $17,989,102.27
PubMed Score 322.59
PubTator Score 185.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
pancreatic cancer -1.300 0.000
malignant mesothelioma -3.100 0.000
oligodendroglioma 2.200 0.005
psoriasis -2.200 0.000
astrocytoma 2.300 0.002
glioblastoma 1.500 0.029
chronic lymphosyte leukemia -1.100 0.012
ependymoma 1.200 0.000
cystic fibrosis 1.198 0.000
group 4 medulloblastoma 1.500 0.001
primitive neuroectodermal tumor 1.200 0.013
Atopic dermatitis -1.400 0.015
tuberculosis 1.300 0.000
non-small cell lung cancer -1.192 0.000
Hydrolethalus syndrome 1.887 0.038
colon cancer -2.200 0.000
lung cancer -3.200 0.000
active Crohn's disease -1.053 0.028
fibroadenoma -1.200 0.003
Breast cancer -2.400 0.026
pancreatic carcinoma -1.300 0.000
lung adenocarcinoma -1.800 0.000
breast carcinoma -1.300 0.000
Pick disease 1.500 0.005
ductal carcinoma in situ -1.700 0.001
invasive ductal carcinoma -1.800 0.003
ovarian cancer -3.600 0.000
pituitary cancer -1.800 0.007
Down syndrome 1.800 0.002

Synonym

Accession Q9H3M7 B4E3D3 Q16226 Q6PML0 Q9BXG9
Symbols THIF
VDUP1
ARRDC6
HHCPA78
EST01027

Gene

PDB

4ROJ   5DF6   4GEI   4GEJ   4GFX   4LL1   4LL4   4ROF   5CQ2   5DWS   5DZD  

Gene RIF (116)

PMID Text
26919541 The crystal structure of the complex between a phosphorylated PPxY motif of TXNIP and the SH2 domain of Vav2 reveals a conserved recognition mechanism.
26858253 These findings thereby provide new mechanistic insight into the regulation of TXNIP and beta-cell biology and reveal novel links between proinflammatory cytokines, carbohydrate response element binding protein-mediated transcription, and microRNA signaling.
26196741 Activation of the miR-373-TXNIP-HIF1alpha-TWIST signaling axis is correlated with a worse outcome in patients with breast cancer.
26147751 Metformin down-regulates high-glucose-induced TXNIP transcription by inactivating ChREBP and FOXO1 in endothelial cells, partially through AMP-activated protein kinase activation
26122224 The protein expression level of TXNIP was negatively correlated with the level of miR-373 in MCF-7 cells and in breast cancer tissue of various migration and invasion abilities. TXNIP was regulated by miR-373.
26116899 HIV-1 Vpr upregulates the gene expression of TXNIP in human monocyte-derived dendritic cells
25870263 data suggest that loss of the p53 tumor suppressor cooperates with Mychigh/TXNIPlow-driven metabolic dysregulation to drive the aggressive clinical behavior of TNBC.
25854388 Expression of TXNIP was up-regulated in all three NSCLC cell lines.
25834832 HG-induced NADPH oxidase activation is driven by TXNIP which subsequently triggers NALP3 inflammasome activation in podocytes and ultimately led to podocyte injury
25812606 our data support the hypothesis that TXNIP is an effective target for the treatment of breast cancer.
More...

AA Sequence

MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYL      1 - 70
RYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETK     71 - 140
KNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVV    141 - 210
PKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYV    211 - 280
SVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTP    281 - 350
LLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ                                 351 - 391
//

Text Mined References (129)

PMID Year Title
26919541 2016 Structural basis for a novel interaction between TXNIP and Vav2.
26858253 2016 Cytokines Regulate ?-Cell Thioredoxin-interacting Protein (TXNIP) via Distinct Mechanisms and Pathways.
26196741 2015 MiR-373 drives the epithelial-to-mesenchymal transition and metastasis via the miR-373-TXNIP-HIF1?-TWIST signaling axis in breast cancer.
26147751 2015 New Insight Into Metformin Action: Regulation of ChREBP and FOXO1 Activities in Endothelial Cells.
26122224 INFLUENCE OF miR-373 ON THE INVASION AND MIGRATION OF BREAST CANCER AND THE EXPRESSION LEVEL OF TARGET GENES TXNIP.
25870263 2015 Metabolic reprogramming in triple-negative breast cancer through Myc suppression of TXNIP.
25854388 2015 Hypoxia induced high expression of thioredoxin interacting protein (TXNIP) in non-small cell lung cancer and its prognostic effect.
25834832 2015 NADPH oxidase-induced NALP3 inflammasome activation is driven by thioredoxin-interacting protein which contributes to podocyte injury in hyperglycemia.
25812606 2015 Epigenetic bivalent marking is permissive to the synergy of HDAC and PARP inhibitors on TXNIP expression in breast cancer cells.
25754218 2015 Foam cell-derived 4-hydroxynonenal induces endothelial cell senescence in a TXNIP-dependent manner.
More...