Property Summary

NCBI Gene PubMed Count 125
PubMed Score 322.59
PubTator Score 185.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
pancreatic cancer -1.300 1.5e-04
malignant mesothelioma -3.100 1.0e-06
oligodendroglioma 2.200 5.1e-03
psoriasis -2.200 4.0e-04
astrocytoma 2.300 2.0e-03
glioblastoma 1.500 2.9e-02
chronic lymphosyte leukemia -1.100 1.2e-02
ependymoma 1.200 3.5e-04
cystic fibrosis 1.198 4.5e-05
group 4 medulloblastoma 1.500 1.5e-03
primitive neuroectodermal tumor 1.200 1.3e-02
Atopic dermatitis -1.400 1.5e-02
tuberculosis 1.300 5.3e-05
non-small cell lung cancer -1.192 2.2e-09
Hydrolethalus syndrome 1.887 3.8e-02
colon cancer -2.200 4.9e-06
lung cancer -3.200 6.5e-07
active Crohn's disease -1.053 2.8e-02
fibroadenoma -1.200 3.0e-03
Breast cancer -2.400 2.6e-02
pancreatic carcinoma -1.300 1.5e-04
lung adenocarcinoma -1.800 1.0e-10
breast carcinoma -1.300 1.8e-16
Pick disease 1.500 5.3e-03
ductal carcinoma in situ -1.700 7.8e-04
invasive ductal carcinoma -1.800 3.1e-03
ovarian cancer -3.600 2.5e-11
pituitary cancer -1.800 7.1e-03
Down syndrome 1.800 2.3e-03

Gene RIF (116)

PMID Text
26919541 The crystal structure of the complex between a phosphorylated PPxY motif of TXNIP and the SH2 domain of Vav2 reveals a conserved recognition mechanism.
26858253 These findings thereby provide new mechanistic insight into the regulation of TXNIP and beta-cell biology and reveal novel links between proinflammatory cytokines, carbohydrate response element binding protein-mediated transcription, and microRNA signaling.
26196741 Activation of the miR-373-TXNIP-HIF1alpha-TWIST signaling axis is correlated with a worse outcome in patients with breast cancer.
26147751 Metformin down-regulates high-glucose-induced TXNIP transcription by inactivating ChREBP and FOXO1 in endothelial cells, partially through AMP-activated protein kinase activation
26122224 The protein expression level of TXNIP was negatively correlated with the level of miR-373 in MCF-7 cells and in breast cancer tissue of various migration and invasion abilities. TXNIP was regulated by miR-373.
26116899 HIV-1 Vpr upregulates the gene expression of TXNIP in human monocyte-derived dendritic cells
25870263 data suggest that loss of the p53 tumor suppressor cooperates with Mychigh/TXNIPlow-driven metabolic dysregulation to drive the aggressive clinical behavior of TNBC.
25854388 Expression of TXNIP was up-regulated in all three NSCLC cell lines.
25834832 HG-induced NADPH oxidase activation is driven by TXNIP which subsequently triggers NALP3 inflammasome activation in podocytes and ultimately led to podocyte injury
25812606 our data support the hypothesis that TXNIP is an effective target for the treatment of breast cancer.
25754218 Foam cell-released 4-hydroxnonenal activates PPARdelta in Vascular endothelial cells, leading to increased TXNIP expression and consequently to senescence.
25726203 The expression of TXNIP was significantly higher in normal-weight type- 2 diabetic patients than in obese ones.
25605021 Suggest that TXNIP plays a critical role in anti-Her-1/Her-2 treatment and may be a potential prognostic marker in breast cancer.
25341426 Data identify the metastasis suppressor TXNIP as new target of miR-224/miR-452 that induces feedback inhibition of E2F1 and show that miR-224/452-mediated downregulation of TXNIP is essential for E2F1-induced EMT and invasion
25332233 regulatory relationship between mTOR and the MondoA-TXNIP axis that we propose contributes to glucose homeostasis
24925443 diabetes was associated with a >30-fold increase in TxnIP gene expression and a 17 % increase in TxnIP protein expression.
24911120 TXNIP has been discovered to control pancreatic B-cell microRNA expression, B-cell function, and insulin production. [Review]
24878528 Our data suggest that glucose-induced BCL-6 overexpression could abrogate the etoposide chemotherapy effect on tumor cell death.
24843047 Txnip is located in the endoplasmic reticulum and interacts with endogenous PDIA6. Txnip increases PDI activity.
24720336 Data suggest that hyperglycemia, as exhibited in 85% of pancreatic cancer patients, up-regulates expression of TXNIP and modulates activity of TRX (thioredoxin) and production of reactive oxygen species in pancreatic cancer cells.
24645981 Our findings indicate that TXNIP functions as a tumor suppressor in thyroid cells, and its downregulation is likely important in the transition from differentiated to advanced thyroid cancer
24628418 TXNIP stimulates its own expression by promoting dephosphorylation and nuclear translocation of its transcription factor, carbohydrate response element-binding protein.
24492284 Hyperglycemia leads to dysfunction of autophagy in renal tubular cells and decreases autophagic clearance. HG-induced overexpression of TXNIP may contribute to the dysfunction of tubular autophagy in diabetes.
24389582 The inhibition of TRX by TXNIP is mediated by an intermolecular disulphide interaction resulting from a novel disulphide bond-switching mechanism. This bond dissociates in the presence of high concentrations of reactive oxygen species.
24376827 Over-expression of TXNIP abolishes nuclear migration of TRX-1 under nitrosative/oxidative stress conditions.
24283717 TXNIP is a promising new target for the development of new therapies for the treatment of retinal neurodegenerative diseases.
24198286 These data implicate a critical role for TXNIP in diabetes-related impairment of ischemia-mediated angiogenesis and identify TXNIP as a potential therapeutic target for the vascular complications of diabetes.
24041652 Knockdown of TXNIP inhibits high glucose-induced activation of p38 MAPK and ERK1/2 and ameliorates high glucose-induced epithelial to mesenchymal transition in renal tubular epithelial cells.
23880345 TXNIP has a role in the pathway involving hEcd to increase p53 stability and activity
23803610 FOXO1 inhibits beta cell TXNIP transcription and suggest that FOXO1 confers this inhibition by interfering with ChREBP DNA binding at target gene promoters.
23691179 Thioredoxin interacting protein is a potential regulator of glucose and energy homeostasis in endogenous Cushing's syndrome.
23520550 Suppression of Txnip by lipopolysaccharide is accompanied by a decrease of the glucose sensing transcription factor MondoA in the nuclei.
23519408 The crystal structure of the N-terminal domain of TXNIP is reported, providing the first structural information on any of the alpha-arrestins.
23461678 Serum TXNIP is elevated in women with polycystic ovary syndrome and may be a contributing factor for insulin resistance.
23454121 Using a hepatocellular carcinoma cell line, we have found that TXNIP mRNA expression is regulated in a biphasic manner in hypoxia whereby TXNIP expression showed an initial rapid decrease, followed by an increase under prolonged hypoxia.
23453806 Glucose influx through GLUT1 restores ATP-to-ADP ratios in the short run and ultimately induces TXNIP protein production.
23393387 TXNIP is essential for VEGFR2 internalization in Rab5 positive endosomes, which is required for endothelial cell growth and angiogenesis.
23387972 The results for the first time demonstrate FAK-regulated TXNIP expression which is important for apoptotic, survival and oxidative stress signaling pathways in cancer cells.
23291592 high cellular levels of TBP-2 can potentially suppress Thioredoxin bioavailability and increase oxidation sensitivity. Overexpression of TBP-2 also causes slow growth by mitotic arrest and apoptosis by activating the ASK death pathway.
23152583 insulin stimulates Txnip degradation by a PI3 kinase-dependent mechanism, which activates the ubiquitin/proteasome pathway and likely serves to mitigate insulin resistance
23112551 TXNIP is underexpressed in 85% of gastric cancer cells
22768160 TBP-2 deficiency enhances TGF-beta signaling and promotes TGF-beta-induced epithelial-mesenchymal transition.
22760822 A thioredoxin interacting protein mutant with all but one cysteine changed to serine (Cys247) showed an enhanced capacity to form complexes with TRX.
22750447 an overview of TXNIP protein and function
22450549 Data indicate that TXNIP may mediate some of the detrimental effects of glucocorticoids on osteoblast (OB) function as well as modulate OB-mediated osteoclastogenesis by regulating the OPG/RANKL ratio.
22267843 Thioredoxin interacting protein promotes endothelial cell inflammation in response to disturbed flow by increasing leukocyte adhesion and repressing Kruppel-like factor 2.
22236479 Suggest that genetic variation in the TXNIP gene may act as a "common ground" modulator of diabetes and hypertension.
22113441 Findings indicated that the TXNIP G allele may contribute to increased arterial stiffness in the Brazilian general population and suggest a possible interaction with diabetes.
21929372 The TXNIP transcription and protein stability are highly regulated by multiple tissue-specific stimuli, it appears that TXNIP should be a good therapeutic target for metabolic diseases.
21916829 Chronic lymphocytic leukemia samples had an average of 57% higher TXNIP RNA levels, which correlated positively with reactive oxygen species levels. This was also seen in a transgenic mouse model.
21908621 the MondoA-TXNIP regulatory circuit has a role in the hexose transport curb, although other redundant pathways also contribute
21771725 Loss of TXNIP is associated with bladder carcinogenesis.
21705327 thioredoxin regulates the intrinsic function of Txnip as an inhibitor of adipogenesis through protein stabilization.
21636804 role for the TXNIP-TRX1 complex to enable inflammation by promoting endothelial cell survival and vascular endothelial growth factor signaling under conditions of physiological oxidative stress
21543874 N-terminal domain of TXNIP has been crystallized. The crystals belonged to a monoclinic space group and diffracted to 3 A resolution using synchrotron radiation
21510938 knockdown of TXNIP prevented high glucose-induced cell apoptosis and activation of ASK1 may be via reduction of oxidative stress in mesangial cells.
21460850 these results collectively demonstrate that TXNIP stabilizes Redd1 protein induced by ATF4 in response to 2-DG, resulting in potentiation of mTOR suppression.
21448924 This study investigated the effect of glucose on GSK3beta and beta-catenin expression and the involvement of the Wnt pathway in response to conditions resembling normoglycemia and hyperglycemia.
21439723 TXNIP expression is increased by the combination of radiation and D-allose in human head and neck cancer cells
21271679 Breast cancer cell line studies showed that microRNA, miR-373, was capable of promoting breast cancer invasion and metastasis via translational inhibition of TXNIP and RABEP1 that were the direct target genes of miR-373.
21192937 Data indicate that down-regulation of Txnip via reduced mRNA transcription may be an important cellular compensatory mechanism in response to hypoxia; cancer cells may regulate metabolism in low oxygen concentrations through such a mechanism.
21151022 transfection experiment showed that TBP-2 expression induced apoptosis in IL-2-independent adult T-cell leukemia cells
20844768 Induction of TXNIP under lactic acidosis is caused by the activation of the glucose-sensing helix-loop-helix transcriptional complex MondoA:Mlx, which is usually triggered upon glucose exposure.
20826751 VDUP1 negatively regulates hepatocarcinogenesis by suppressing TNF-alpha-induced NF-kappaB activation.
20680488 HDAC10 is involved in transcriptional downregulation of TXNIP, leading to altered reactive oxygen species signaling in human gastric cancer cells.
20656682 VDUP1 expression was regulated by FOXO3A at the transcriptional level and by miR-17-5p at the post-transcriptional levels during the senescence process.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20584310 Low expression of TXNIP is associated with breast cancer.
20558747 Findings suggest that the Txnip expression is tightly correlated with glycolytic flux, which is regulated by oxidative phosphorylation status
20398702 TBP-2 is directly involved in the switching of glucocorticoid (GC) sensitivity and GC resistance in HTLV-I infected T cell lines.
20172870 TBP-2 mRNA levels in the endometrium were lower, and the TRX to TBP-2 ratio was higher in patients with endometriosis than in the control group.
20068034 itch regulates apoptosis by targeting thioredoxin-interacting protein for ubiquitin-dependent degradation
20027290 These findings suggest a synergy between the tandem CCAAT and carbohydrate response element motifs and associated NF-Y and Mondo/MLX transcription factors in enhancing transcription from the Txnip promoter.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19847012 Thioredoxin-interacting protein (Txnip) is a feedback regulator of S-nitrosylation.
19808645 Data suggest that Txnip expression and promoter activity are mediated via divergent effects of KLF6 and PPAR-gamma transcriptional regulation.
19773351 p21(WAF1) can induce thioredoxin secretion and angiogenesis in cancer cells, by direct transcriptional repression of the thioredoxin-binding protein 2 promoter
19619006 Data suggest that thioredoxin binding protein 2 modulates lipid metabolism as well as natural killer T cell activity.
19605364 Txnip regulates cellular metabolism independent of its binding to thioredoxin and the arrestin domains are crucial structural elements in metabolic functions of alpha-arrestin proteins
19327827 TXNIP expression contributes to mouse leukemia virus-induced murine leukemia as well as human acute myelocytic leukemia.
19254690 upregulation of Txnip and subsequent impairment of thioredoxin antioxidative system through p38 MAPK and FOXO1 may represent a novel mechanism for glucose-induced increase in intracellular ROS.
19246513 The transcription of the Txnip gene is induced by adenosine-containing molecules, of which an intact adenosine moiety is necessary and sufficient.
19214472 Repression of TXNIP by insulin is probably an important compensatory mechanism protecting beta cells from oxidative damage and apoptosis in type 2 diabetes.
19052253 TXNIP is transcription induced in carcinoma cells in an increased glucose metabolism-dependent or -independent response, and a putative glucose regulatory system including ChREBP and ChoRE is needed for glucose-induced TXNIP gene in prostate carcinoma
19018770 TXNIP is involved in the antitumor activity of CD437.
18974842 Observational study of gene-disease association. (HuGE Navigator)
18848838 stimulation of PPARalpha in human macrophages might reduce arterial inflammation through differential regulation of the Trx-1 and VDUP-1 gene expression
18835792 The expressions of hypoxia inducible factor 1alpha, vascular endothelial growth factor-A, thioredoxin, and thioredoxin interacting protein were related to macrophage infiltration rather than neovascularization in carotid atherosclerotic plaques
18793170 Results show that inhibition of TXNIP protects against glucotoxic beta-cell apoptosis and therefore may represent a novel therapeutic approach to halt diabetes progression.
18541147 These studies indicate that hnRNP G promotes the expression of Txnip and mediates its tumor-suppressive effect.
18458340 These studies suggest a key role for MondoA:Mlx complexes in the adaptive transcriptional response to changes in extracellular glucose concentration and peripheral glucose uptake.
18376310 TXNIP is induced in response to hypoxia in a HIF-1alpha-dependent manner in pancreatic cancer cells, resulting in increased apoptosis and increased sensitivity to platinum anticancer therapy.
18301748 TXNIP is directly repressed by FOXO1a, modulating the cellular response to oxidative stress and affecting life span
18202760 D-allose, a simple monosaccharide, may act to cause TXNIP induction and p27kip1 protein stabilization in tumor cells
17675577 Results suggest that high glucose induces Txnip through a TGF-beta1-independent pathway.
17671698 downregulation of TXNIP may be partly involved in the pathogenesis of ulcerative colitis, including inflammation and colitis-associated colon carcinogenesis.
17579352 Enhanced VDUP1 gene expression by PPARgamma agonist induces apoptosis in human macrophages.
17555594 In response to glucose, increased level of TXNIP RNA is followed by increased level of protein that is associated with increasing levels of reactive oxygen species (ROS) and reduced thioredoxin activity in a metastatic breast cancer-derived cell line.
17472435 TXNIP regulates both insulin-dependent and insulin-independent pathways of glucose uptake in human skeletal muscle. Data suggests that TXNIP might play a key role in defective glucose homeostasis preceding overt type 2 diabetes mellitus.
17381501 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17381501 first report to implicate TXNIP in Type 2 diabetes; effect of TXNIP on triglycerides is influenced by plasma glucose concentration, suggesting biological relevance of TXNIP variations may be particularly relevant in recurrent episodes of hyperglycaemia
16766796 identified two Txnip cysteines that are important for thioredoxin binding and showed that this interaction is consistent with a disulfide exchange reaction between oxidized Txnip and reduced thioredoxin
16766796 Txnip cysteines 63 and 247 are important for formation of a disulfide-linked complex with thioredoxin that inhibits thioredoxin's reducing activity
16723126 By Northern blot, we confirm hypoxia-induced expression of insulin-like growth factor binding protein 3 (igfbp3), thioredoxin-interacting protein (txnip), neuritin (nrn1).
16301999 findings indicate that txnip is a novel glucocorticoid-induced primary target gene involved in mediating glucocorticoid-induced apoptosis
15705778 thioredoxin-interacting protein (TXNIP)is a novel proapoptotic beta-cell gene elevated in insulin resistance/diabetes and up-regulated by glucose through a unique carbohydrate response element
15696199 Data suggest that thioredoxin-interacting protein and thioredoxin are key components of biomechanical signal transduction and establish them as potentially novel regulators of tumor necrosis factor signaling and inflammation in endothelial cells.
15537450 thioredoxin binding protein-2 and redox-sensitive signaling regulate human osteoclast differentiation
15234975 interaction of TBP-2 was specific to Rch1 among other importin alpha subfamilies
15136067 TXNIP gene does not ply a major role in familial combined hyperlipidemia, or related traits.
15128745 reduced thioredoxin activity through interaction with Txnip is an important mechanism for vascular oxidative stress in diabetes mellitus
14766217 VDUP1 is upregulated by heat shock factor during stresses such as high density and serum deprivation cultures
14632196 VDUP1 could have a unique role in epidermis regulating the conversion of postmitotic cells to differentiating ones.
12821938 VDUP1 is a novel antitumor gene which forms a transcriptional repressor complex
12189205 association of induction with decreased mRNA levels in prostate cancer cells [thioredoxin-binding protein 2]
12054598 overexpression of mRNA sensitized HeLa cells to paraquat

AA Sequence

MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYL      1 - 70
RYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETK     71 - 140
KNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVV    141 - 210
PKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYV    211 - 280
SVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTP    281 - 350
LLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ                                 351 - 391
//

Text Mined References (129)

PMID Year Title
26919541 2016 Structural basis for a novel interaction between TXNIP and Vav2.
26858253 2016 Cytokines Regulate ?-Cell Thioredoxin-interacting Protein (TXNIP) via Distinct Mechanisms and Pathways.
26196741 2015 MiR-373 drives the epithelial-to-mesenchymal transition and metastasis via the miR-373-TXNIP-HIF1?-TWIST signaling axis in breast cancer.
26147751 2015 New Insight Into Metformin Action: Regulation of ChREBP and FOXO1 Activities in Endothelial Cells.
26122224 INFLUENCE OF miR-373 ON THE INVASION AND MIGRATION OF BREAST CANCER AND THE EXPRESSION LEVEL OF TARGET GENES TXNIP.
25870263 2015 Metabolic reprogramming in triple-negative breast cancer through Myc suppression of TXNIP.
25854388 2015 Hypoxia induced high expression of thioredoxin interacting protein (TXNIP) in non-small cell lung cancer and its prognostic effect.
25834832 2015 NADPH oxidase-induced NALP3 inflammasome activation is driven by thioredoxin-interacting protein which contributes to podocyte injury in hyperglycemia.
25812606 2015 Epigenetic bivalent marking is permissive to the synergy of HDAC and PARP inhibitors on TXNIP expression in breast cancer cells.
25754218 2015 Foam cell-derived 4-hydroxynonenal induces endothelial cell senescence in a TXNIP-dependent manner.
25726203 2014 Glycemic control and oxidative stress markers and their relationship with the thioredoxin interacting protein (TXNIP) gene in type 2 diabetic patients.
25605021 2015 TXNIP interaction with the Her-1/2 pathway contributes to overall survival in breast cancer.
25341426 2014 E2F1 induces miR-224/452 expression to drive EMT through TXNIP downregulation.
25332233 2015 MondoA-Mlx transcriptional activity is limited by mTOR-MondoA interaction.
24925443 2014 Impaired cardiac anti-oxidant activity in diabetes: human and correlative experimental studies.
24911120 2014 Minireview: Thioredoxin-interacting protein: regulation and function in the pancreatic ?-cell.
24878528 2014 High concentrations of glucose suppress etoposide-induced cell death of B-cell lymphoma through BCL-6.
24843047 2014 Thioredoxin-interacting protein regulates protein disulfide isomerases and endoplasmic reticulum stress.
24720336 2014 Hyperglycemia regulates TXNIP/TRX/ROS axis via p38 MAPK and ERK pathways in pancreatic cancer.
24645981 2014 Thioredoxin interacting protein (TXNIP) is a novel tumor suppressor in thyroid cancer.
24628418 2014 Thioredoxin-interacting protein stimulates its own expression via a positive feedback loop.
24492284 2014 Thioredoxin-interacting protein mediates dysfunction of tubular autophagy in diabetic kidneys through inhibiting autophagic flux.
24389582 2014 The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein.
24376827 2013 Nitrosative/oxidative stress conditions regulate thioredoxin-interacting protein (TXNIP) expression and thioredoxin-1 (TRX-1) nuclear localization.
24283717 2014 Deletion of thioredoxin-interacting protein preserves retinal neuronal function by preventing inflammation and vascular injury.
24198286 2014 A critical role for thioredoxin-interacting protein in diabetes-related impairment of angiogenesis.
24041652 2013 Knockdown of thioredoxin-interacting protein ameliorates high glucose-induced epithelial to mesenchymal transition in renal tubular epithelial cells.
23880345 2013 TXNIP interacts with hEcd to increase p53 stability and activity.
23803610 2013 FOXO1 competes with carbohydrate response element-binding protein (ChREBP) and inhibits thioredoxin-interacting protein (TXNIP) transcription in pancreatic beta cells.
23691179 2013 Thioredoxin interacting protein is a potential regulator of glucose and energy homeostasis in endogenous Cushing's syndrome.
23520550 2013 Thioredoxin-interacting protein gene expression via MondoA is rapidly and transiently suppressed during inflammatory responses.
23519408 2013 Structure of the N-terminal domain of human thioredoxin-interacting protein.
23461678 2014 Elevated serum thioredoxin-interacting protein in women with polycystic ovary syndrome is associated with insulin resistance.
23454121 2013 Mechanistic target of rapamycin (mTOR) dependent regulation of thioredoxin interacting protein (TXNIP) transcription in hypoxia.
23453806 2013 AMPK-dependent degradation of TXNIP upon energy stress leads to enhanced glucose uptake via GLUT1.
23393387 2013 Thioredoxin-interacting protein mediates sustained VEGFR2 signaling in endothelial cells required for angiogenesis.
23387972 2014 Focal adhesion kinase regulates expression of thioredoxin-interacting protein (TXNIP) in cancer cells.
23291592 2013 Overexpression of thioredoxin-binding protein 2 increases oxidation sensitivity and apoptosis in human lens epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152583 2013 Posttranslational regulation of thioredoxin-interacting protein.
23112551 2012 Thioredoxin and thioredoxin-interacting protein as prognostic markers for gastric cancer recurrence.
22768160 2012 Deficiency of thioredoxin binding protein-2 (TBP-2) enhances TGF-? signaling and promotes epithelial to mesenchymal transition.
22760822 2012 Mutagenic analysis in a pure molecular system shows that thioredoxin-interacting protein residue Cys247 is necessary and sufficient for a mixed disulfide formation with thioredoxin.
22750447 2013 Roles of thioredoxin binding protein (TXNIP) in oxidative stress, apoptosis and cancer.
22450549 2012 TXNIP is highly regulated in bone biopsies from patients with endogenous Cushing's syndrome and related to bone turnover.
22267843 2012 Thioredoxin interacting protein promotes endothelial cell inflammation in response to disturbed flow by increasing leukocyte adhesion and repressing Kruppel-like factor 2.
22236479 2012 Thioredoxin interacting protein genetic variation is associated with diabetes and hypertension in the Brazilian general population.
22113441 2012 Thioredoxin interacting protein (TXNIP) rs7212 polymorphism is associated with arterial stiffness in the Brazilian general population.
21929372 2012 Thioredoxin interacting protein: redox dependent and independent regulatory mechanisms.
21916829 2012 Thioredoxin-interacting protein and chronic lymphocytic leukemia.
21908621 2011 MondoA senses non-glucose sugars: regulation of thioredoxin-interacting protein (TXNIP) and the hexose transport curb.
21771725 2011 Thioredoxin-interacting protein suppresses bladder carcinogenesis.
21705327 2011 Thioredoxin regulates adipogenesis through thioredoxin-interacting protein (Txnip) protein stability.
21636804 2011 Thioredoxin-interacting protein mediates TRX1 translocation to the plasma membrane in response to tumor necrosis factor-?: a key mechanism for vascular endothelial growth factor receptor-2 transactivation by reactive oxygen species.
21543874 2011 Crystallization and preliminary X-ray analysis of the N-terminal domain of human thioredoxin-interacting protein.
21510938 2011 Knockdown of thioredoxin interacting protein attenuates high glucose-induced apoptosis and activation of ASK1 in mouse mesangial cells.
21460850 2011 TXNIP potentiates Redd1-induced mTOR suppression through stabilization of Redd1.
21448924 2012 Wnt/?-catenin signaling pathway and thioredoxin-interacting protein (TXNIP) mediate the "glucose sensor" mechanism in metastatic breast cancer-derived cells MDA-MB-231.
21439723 2011 Enhancement of the radiation effects by D-allose in head and neck cancer cells.
21271679 2011 Global identification of miR-373-regulated genes in breast cancer by quantitative proteomics.
21192937 2011 Hypoxia-inducible factor independent down-regulation of thioredoxin-interacting protein in hypoxia.
21151022 2011 Thioredoxin-binding protein-2 (TBP-2/VDUP1/TXNIP) regulates T-cell sensitivity to glucocorticoid during HTLV-I-induced transformation.
20844768 2010 Lactic acidosis triggers starvation response with paradoxical induction of TXNIP through MondoA.
20826751 2010 Vitamin D3 upregulated protein 1 suppresses TNF-?-induced NF-?B activation in hepatocarcinogenesis.
20680488 2010 Inhibition of histone deacetylase 10 induces thioredoxin-interacting protein and causes accumulation of reactive oxygen species in SNU-620 human gastric cancer cells.
20656682 2010 Vitamin D3 up-regulated protein 1(VDUP1) is regulated by FOXO3A and miR-17-5p at the transcriptional and post-transcriptional levels, respectively, in senescent fibroblasts.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20584310 2010 Role of thioredoxin reductase 1 and thioredoxin interacting protein in prognosis of breast cancer.
20558747 2010 Thioredoxin-interacting protein (Txnip) gene expression: sensing oxidative phosphorylation status and glycolytic rate.
20398702 2010 Differential roles of Annexin A1 (ANXA1/lipocortin-1/lipomodulin) and thioredoxin binding protein-2 (TBP-2/VDUP1/TXNIP) in glucocorticoid signaling of HTLV-I-transformed T cells.
20172870 2010 The roles of thioredoxin and thioredoxin-binding protein-2 in endometriosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068034 2010 The ubiquitin ligase itch regulates apoptosis by targeting thioredoxin-interacting protein for ubiquitin-dependent degradation.
20027290 2009 Tandem ChoRE and CCAAT motifs and associated factors regulate Txnip expression in response to glucose or adenosine-containing molecules.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19847012 2009 Thioredoxin-interacting protein (Txnip) is a feedback regulator of S-nitrosylation.
19808645 2009 Transcription factors Krüppel-like factor 6 and peroxisome proliferator-activated receptor-{gamma} mediate high glucose-induced thioredoxin-interacting protein.
19773351 2009 The cyclin-dependent kinase inhibitor, p21(WAF1), promotes angiogenesis by repressing gene transcription of thioredoxin-binding protein 2 in cancer cells.
19619006 2009 Thioredoxin binding protein 2 modulates natural killer T cell-dependent innate immunity in the liver: possible link to lipid metabolism.
19605364 2009 Thioredoxin-independent regulation of metabolism by the alpha-arrestin proteins.
19327827 2009 The gene encoding thioredoxin-interacting protein (TXNIP) is a frequent virus integration site in virus-induced mouse leukemia and is overexpressed in a subset of AML patients.
19254690 2009 Up-regulation of thioredoxin interacting protein (Txnip) by p38 MAPK and FOXO1 contributes to the impaired thioredoxin activity and increased ROS in glucose-treated endothelial cells.
19246513 2009 Adenosine-containing molecules amplify glucose signaling and enhance txnip expression.
19214472 2009 Insulin counteracts glucotoxic effects by suppressing thioredoxin-interacting protein production in INS-1E beta cells and in Psammomys obesus pancreatic islets.
19052253 2009 Thioredoxin-interacting protein: an oxidative stress-related gene is upregulated by glucose in human prostate carcinoma cells.
19018770 2008 Involvement of thioredoxin-binding protein 2 in the antitumor activity of CD437.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18848838 2008 Thioredoxin-1 and its natural inhibitor, vitamin D3 up-regulated protein 1, are differentially regulated by PPARalpha in human macrophages.
18835792 Laser microdissection-based analysis of hypoxia- and thioredoxin-related genes in human stable carotid plaques.
18793170 2008 Lack of TXNIP protects beta-cells against glucotoxicity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18541147 2008 hnRNP G elicits tumor-suppressive activity in part by upregulating the expression of Txnip.
18458340 2008 Glucose sensing by MondoA:Mlx complexes: a role for hexokinases and direct regulation of thioredoxin-interacting protein expression.
18376310 2008 Identification of thioredoxin-interacting protein 1 as a hypoxia-inducible factor 1alpha-induced gene in pancreatic cancer.
18301748 2008 A combination of genomic approaches reveals the role of FOXO1a in regulating an oxidative stress response pathway.
18202760 2008 Rare sugar D-allose induces specific up-regulation of TXNIP and subsequent G1 cell cycle arrest in hepatocellular carcinoma cells by stabilization of p27kip1.
17675577 2007 High glucose-induced thioredoxin-interacting protein in renal proximal tubule cells is independent of transforming growth factor-beta1.
17671698 2007 Decreased expression of thioredoxin interacting protein mRNA in inflamed colonic mucosa in patients with ulcerative colitis.
17603038 2007 Regulation of the bioavailability of thioredoxin in the lens by a specific thioredoxin-binding protein (TBP-2).
17579352 2008 Enhanced VDUP-1 gene expression by PPARgamma agonist induces apoptosis in human macrophage.
17555594 2007 Hyperglycemia regulates thioredoxin-ROS activity through induction of thioredoxin-interacting protein (TXNIP) in metastatic breast cancer-derived cells MDA-MB-231.
17472435 2007 TXNIP regulates peripheral glucose metabolism in humans.
17381501 2007 Genetic variation in thioredoxin interacting protein (TXNIP) is associated with hypertriglyceridaemia and blood pressure in diabetes mellitus.
16766796 2006 The interaction of thioredoxin with Txnip. Evidence for formation of a mixed disulfide by disulfide exchange.
16723126 2006 Characterization of the expression of the hypoxia-induced genes neuritin, TXNIP and IGFBP3 in cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16301999 2006 Thioredoxin-interacting protein (txnip) is a glucocorticoid-regulated primary response gene involved in mediating glucocorticoid-induced apoptosis.
15705778 2005 Thioredoxin-interacting protein is stimulated by glucose through a carbohydrate response element and induces beta-cell apoptosis.
15696199 2005 Fluid shear stress inhibits vascular inflammation by decreasing thioredoxin-interacting protein in endothelial cells.
15537450 2004 Regulation of human osteoclast differentiation by thioredoxin binding protein-2 and redox-sensitive signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15234975 2004 Importin alpha1 (Rch1) mediates nuclear translocation of thioredoxin-binding protein-2/vitamin D(3)-up-regulated protein 1.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15136067 2004 TXNIP gene not associated with familial combined hyperlipidemia in the NHLBI Family Heart Study.
15128745 2004 Hyperglycemia promotes oxidative stress through inhibition of thioredoxin function by thioredoxin-interacting protein.
14766217 2004 Heat shock factor regulates VDUP1 gene expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14632196 2003 The expression of vitamin D-upregulated protein 1 in skin and its interaction with sciellin in cultured keratinocytes.
12821938 2003 VDUP1 upregulated by TGF-beta1 and 1,25-dihydorxyvitamin D3 inhibits tumor cell growth by blocking cell-cycle progression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386145 2002 Vitamin D3-upregulated protein-1 (VDUP-1) regulates redox-dependent vascular smooth muscle cell proliferation through interaction with thioredoxin.
12189205 2002 The histone deacetylase inhibitor SAHA arrests cancer cell growth, up-regulates thioredoxin-binding protein-2, and down-regulates thioredoxin.
11753387 2002 Positional cloning of the combined hyperlipidemia gene Hyplip1.
11376942 2001 Cloning, genetic characterization, and chromosomal mapping of the mouse VDUP1 gene.
10814541 2000 A possible interaction of thioredoxin with VDUP1 in HeLa cells detected in a yeast two-hybrid system.
10419473 1999 Identification of thioredoxin-binding protein-2/vitamin D(3) up-regulated protein 1 as a negative regulator of thioredoxin function and expression.
9207062 1997 Interaction of human apurinic endonuclease and DNA polymerase beta in the base excision repair pathway.
8086474 1994 Isolation and characterization of a novel cDNA from HL-60 cells treated with 1,25-dihydroxyvitamin D-3.