Property Summary

NCBI Gene PubMed Count 5
Grant Count 5
R01 Count 5
Funding $872,301.5
PubMed Score 60.13
PubTator Score 21.68

Knowledge Summary

Patent (3,478)

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group A ependymoma -1.700 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.300 0.001
primitive neuroectodermal tumor -1.200 0.023
lung cancer 1.100 0.008
adult high grade glioma -1.200 0.049
Down syndrome -1.300 0.001

AA Sequence

MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFSLCDDY      1 - 70
DPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEE     71 - 140
IARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVL    141 - 210
DAEGNRVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMM    211 - 280
ELTNVQQAVQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQSHP    281 - 350
ETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINNFVRYYNKQRVLE    351 - 420
TAAKHELELMELNSSSGGEGKTGGSRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPLLTEEKHHRTRL    421 - 490
QSCK                                                                      491 - 494
//

Text Mined References (7)

PMID Year Title
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445884 2002 Expression, regulation and role of the MAGUK protein SAP-97 in human atrial myocardium.
12060745 2002 Obligatory heterotetramerization of three previously uncharacterized Kv channel alpha-subunits identified in the human genome.
9434767 1997 Isolation, characterization, and mapping of two human potassium channels.