Property Summary

NCBI Gene PubMed Count 21
PubMed Score 32.41
PubTator Score 18.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.540 2.5e-03
ovarian cancer -1.700 1.5e-04
pancreatic ductal adenocarcinoma liver m... -1.574 4.5e-02
psoriasis 2.000 5.0e-05

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MANVLCNRARLVSYLPGFCSLVKRVVNPKAFSTAGSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQ      1 - 70
RFQLPGNIGFDCHLNGTASQKKSLVHKTLPDVLAEPLSSERHEFVMAQYVNEFQGNDAPVEQEINSAETY     71 - 140
FESARVECAIQTCPELLRKDFESLFPEVANGKLMILTVTQKTKNDMTVWSEEVEIEREVLLEKFINGAKE    141 - 210
ICYALRAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVIRHSLWGTHVVVGSIF    211 - 280
TNATPDSHIMKKLSGN                                                          281 - 296
//

Text Mined References (20)

PMID Year Title