Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.49

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRLVNACLAEELPHIHAF      1 - 70
EQKTLTPDQWARERQK                                                           71 - 86
//

Text Mined References (11)

PMID Year Title