Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.12

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRLVNACLAEELPHIHAF      1 - 70
EQKTLTPDQWARERQK                                                           71 - 86
//

Text Mined References (9)

PMID Year Title
26613676 2015 Elucidating the Molecular Function of Human BOLA2 in GRX3-Dependent Anamorsin Maturation Pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22309771 2012 Human glutaredoxin 3 forms [2Fe-2S]-bridged complexes with human BolA2.
21269460 2011 Initial characterization of the human central proteome.
18548201 2008 hBolA, novel non-classical secreted proteins, belonging to different BolA family with functional divergence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14718656 2004 Solution structure of a BolA-like protein from Mus musculus.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.