Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
Funding $141,468.66
PubMed Score 64.14
PubTator Score 22.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q9H3K2 A8K9Z9 D3DWE0 O95894 Q5VT95 Q9H0P2
Symbols DERP2
MICS1
My021
PTD010
TMBIM5
HSPC282

Gene

 Grant Application (2)

 GO Process (1)

Gene RIF (6)

PMID Text
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
20877624 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18440869 The tmbim5 may participate in cell death regulation by interacting with proteins of Bcl-2 family, promoting tumor metastasis, which is deduced from the evolutionary conservation of the membrane protein family containing multiple membrane spanning segments
18417609 MICS1 individually functions in mitochondrial morphology and cytochrome c release.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPS      1 - 70
MEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTAL     71 - 140
SAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTIL    141 - 210
GGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAM    211 - 280
YGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK         281 - 345
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18440869 2008 Comparative genomics and function analysis on BI1 family.
18417609 2008 Identification of a novel protein MICS1 that is involved in maintenance of mitochondrial morphology and apoptotic release of cytochrome c.
More...