Property Summary

NCBI Gene PubMed Count 21
PubMed Score 66.54
PubTator Score 22.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 5.7e-04
Alzheimer's disease -1.200 2.3e-02
atypical teratoid / rhabdoid tumor -1.500 3.2e-08
glioblastoma -1.200 2.9e-04
medulloblastoma -1.400 1.7e-06
medulloblastoma, large-cell -1.400 1.9e-05
Multiple myeloma 1.731 4.2e-04
non primary Sjogren syndrome sicca 1.200 2.6e-02
ovarian cancer -1.200 5.7e-04
pancreatic ductal adenocarcinoma liver m... -1.378 2.2e-02
Pick disease -1.500 7.9e-07
Waldenstrons macroglobulinemia 1.058 2.8e-02

Gene RIF (6)

AA Sequence

MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPS      1 - 70
MEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTAL     71 - 140
SAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTIL    141 - 210
GGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAM    211 - 280
YGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK         281 - 345
//

Text Mined References (24)

PMID Year Title