Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.34
PubTator Score 12.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.4e-03
tuberculosis and treatment for 6 months 1.200 8.2e-04

Gene RIF (8)

AA Sequence

MSTVGLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGP      1 - 70
GGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAAKKKQE     71 - 140
RKKRAKETLEKKKLLKELWESSKKVH                                                141 - 166
//

Text Mined References (19)

PMID Year Title