Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.26
PubTator Score 0.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
10051408 Characterizes TCEAL1, another member of the human TCEAL gene family.

AA Sequence

MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKA      1 - 70
KGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSEREPESEGEPESETRAAGKRPAEDDIPRKAKR     71 - 140
KTNKGLAQYLKQYKEAIHDMNFSNEDMIREFDNMARVEDKRRKSKQKLGAFLWMQRNLQDPFYPRGPREF    141 - 210
RGGCRAPRRDTEDIPYV                                                         211 - 227
//

Text Mined References (8)

PMID Year Title
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10051408 1999 Genomic structure and chromosomal localization of TCEAL1, a human gene encoding the nuclear phosphoprotein p21/SIIR.
9776767 1998 A method for global protein expression and antibody screening on high-density filters of an arrayed cDNA library.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.