Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.26
PubTator Score 0.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.507 1.2e-02
adult high grade glioma -1.700 1.5e-04
aldosterone-producing adenoma -1.567 6.9e-03
atypical teratoid / rhabdoid tumor -3.600 1.2e-04
Breast cancer -3.700 1.0e-55
colon cancer -4.700 2.0e-09
ependymoma -1.500 8.1e-05
glioblastoma -1.700 4.4e-04
group 3 medulloblastoma -2.400 3.7e-04
interstitial cystitis -2.000 3.7e-04
intraductal papillary-mucinous adenoma (... -4.200 5.9e-07
intraductal papillary-mucinous carcinoma... -4.400 1.3e-09
intraductal papillary-mucinous neoplasm ... -4.600 8.7e-07
invasive ductal carcinoma -1.200 1.1e-02
lung adenocarcinoma -1.800 4.0e-11
lung cancer -2.200 2.9e-05
lung carcinoma 1.200 8.2e-23
medulloblastoma, large-cell -5.700 2.3e-07
non-small cell lung cancer -1.694 1.8e-11
ovarian cancer -6.500 2.6e-20
primitive neuroectodermal tumor -1.300 4.7e-04
psoriasis -1.800 1.3e-58

Gene RIF (1)

AA Sequence

MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKA      1 - 70
KGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSEREPESEGEPESETRAAGKRPAEDDIPRKAKR     71 - 140
KTNKGLAQYLKQYKEAIHDMNFSNEDMIREFDNMARVEDKRRKSKQKLGAFLWMQRNLQDPFYPRGPREF    141 - 210
RGGCRAPRRDTEDIPYV                                                         211 - 227
//

Text Mined References (8)

PMID Year Title