Property Summary

NCBI Gene PubMed Count 36
PubMed Score 571.21
PubTator Score 64.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
osteosarcoma 7950 2.9e-06
tuberculosis 2010 3.8e-06
ovarian cancer 8520 3.6e-05
Multiple myeloma 1332 5.3e-04
lung cancer 4740 3.8e-03
non primary Sjogren syndrome sicca 891 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.600 3.8e-03
Multiple myeloma 1.482 5.3e-04
non primary Sjogren syndrome sicca 1.100 2.3e-02
osteosarcoma -2.198 2.9e-06
ovarian cancer 1.400 3.6e-05
tuberculosis 1.600 3.8e-06

Protein-protein Interaction (5)

Gene RIF (15)

AA Sequence

MWAFSELPMPLLINLIVSLLGFVATVTLIPAFRGHFIAARLCGQDLNKTSRQQIPESQGVISGAVFLIIL      1 - 70
FCFIPFPFLNCFVKEQCKAFPHHEFVALIGALLAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLMVY     71 - 140
FTNFGNTTIVVPKPFRPILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNL    141 - 210
VELEGDCRDDHVFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFM    211 - 280
PQVFNFLYSLPQLLHIIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSET    281 - 350
EDGEFTECNNMTLINLLLKVLGPIHERNLTLLLLLLQILGSAITFSIRYQLVRLFYDV                351 - 408
//

Text Mined References (35)

PMID Year Title