Property Summary

NCBI Gene PubMed Count 35
Grant Count 98
R01 Count 72
Funding $22,617,833.28
PubMed Score 552.35
PubTator Score 64.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.482 0.001
osteosarcoma -2.198 0.000
tuberculosis 1.600 0.000
lung cancer 1.800 0.000
non primary Sjogren syndrome sicca 1.100 0.023
ovarian cancer 1.400 0.000

Synonym

Accession Q9H3H5 O15216 Q86WV9 Q9BWE6
Symbols GPT
ALG7
DGPT
G1PT
UAGT
UGAT
CDG1J
CMS13
DPAGT
CDG-Ij
CMSTA2
DPAGT2
D11S366

Gene

PANTHER Protein Class (2)

Gene RIF (14)

PMID Text
25408354 Data suggest that N-acetylglucosaminyl 1-phosphate transferase is a breast cancer therapeutic target.
23703614 Data suggest that in oral squamous cell carcinoma (OSCC), dysregulation of canonical Wnt signaling and DPAGT1-dependent N-glycosylation induces CTHRC1, thereby driving OSCC cell migration and tumor spread.
23591138 prominent limb-girdle weakness and minimal craniobulbar symptoms who harbour a novel mutation in DPAGT1
23447650 Patients with DPAGT1 CMS share similar clinical features with patients who have CMS caused by mutations in GFPT1, another recently identified CMS subtype.
23278575 suggest that the primary pathogenic mechanism of DPAGT1-associated CMS is reduced levels of AChRs at the endplate region. This finding demonstrates that impairment of the N-linked glycosylation pathway can lead to the development of CMS
23249953 Results indicate that the clinical spectrum of dolichyl-phosphate alpha-N-acetylglucosaminyltransferase (DPAGT1)-congenital disorders of glycosylation (CDG) is much broader than appreciated so far.
23178939 Studies show that cells coordinate DPAGT1 expression and protein N-glycosylation with canonical Wnt signaling and E-cadherin adhesion via positive and negative feedback mechanisms.
22742743 We identify DPAGT1 as a gene in which mutations cause a congenital myasthenic syndrome.
22341307 Overexpression of DPAGT1 in human oral squamous cell carcinoma specimens is linked to aberrant activation of canonical Wnt signaling.
22304930 Mutations in DPAGT1 gene is associated with Congenital disorder of glycosylation type Ij.
More...

AA Sequence

MWAFSELPMPLLINLIVSLLGFVATVTLIPAFRGHFIAARLCGQDLNKTSRQQIPESQGVISGAVFLIIL      1 - 70
FCFIPFPFLNCFVKEQCKAFPHHEFVALIGALLAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLMVY     71 - 140
FTNFGNTTIVVPKPFRPILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNL    141 - 210
VELEGDCRDDHVFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFM    211 - 280
PQVFNFLYSLPQLLHIIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSET    281 - 350
EDGEFTECNNMTLINLLLKVLGPIHERNLTLLLLLLQILGSAITFSIRYQLVRLFYDV                351 - 408
//

Text Mined References (34)

PMID Year Title
25408354 2015 N-acetylglucosaminyl 1-phosphate transferase: an excellent target for developing new generation breast cancer therapeutic.
23703614 2013 N-glycosylation induces the CTHRC1 protein and drives oral cancer cell migration.
23591138 2013 Clinical features in a large Iranian family with a limb-girdle congenital myasthenic syndrome due to a mutation in DPAGT1.
23447650 2013 Clinical features of congenital myasthenic syndrome due to mutations in DPAGT1.
23278575 2012 Identification of DPAGT1 as a new gene in which mutations cause a congenital myasthenic syndrome.
23249953 2013 A compound heterozygous mutation in DPAGT1 results in a congenital disorder of glycosylation with a relatively mild phenotype.
23178939 2013 Coordinate regulation of N-glycosylation gene DPAGT1, canonical Wnt signaling and E-cadherin adhesion.
22742743 2012 Mutations in DPAGT1 cause a limb-girdle congenital myasthenic syndrome with tubular aggregates.
22341307 2012 Aberrant amplification of the crosstalk between canonical Wnt signaling and N-glycosylation gene DPAGT1 promotes oral cancer.
22304930 2012 Congenital disorder of glycosylation type Ij (CDG-Ij, DPAGT1-CDG): extending the clinical and molecular spectrum of a rare disease.
More...