Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.03
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.2e-06

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 2.2e-06

Synonym

Accession Q9H3H3 J3KQG9 Q9BT13
Symbols P5326
BLES03

Gene

PDB

1ZTP   2Q4K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MEPGEELEEEGSPGGREDGFTAEHLAAEAMAADMDPWLVFDARTTPATELDAWLAKYPPSQVTRYGDPGS      1 - 70
PNSEPVGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPGTLRQLAITHHVLSGKWLMHLAPGFKLD     71 - 140
HAWAGIARAVVEGQLQVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKCLLTYKPDVYTY    141 - 210
LGIYRANRWHLCPTLYESRFQLGGSARGSRVLDRANNVELT                                 211 - 251
//

Text Mined References (15)

PMID Year Title