Property Summary

NCBI Gene PubMed Count 18
PubMed Score 229.65
PubTator Score 217.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Precancerous Conditions 69
Disease Target Count P-value
lung cancer 4473 7.55022325759865E-6
osteosarcoma 7933 3.05430509648165E-5
interstitial cystitis 2299 4.97488554319323E-5
Pick disease 1893 5.11544591596104E-5
psoriasis 6685 2.02032839909454E-4
ovarian cancer 8492 4.8503854060662E-4
progressive supranuclear palsy 674 0.02184780247938
Disease Target Count Z-score Confidence
Tinea pedis 30 3.92 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -1.559 0.000
lung cancer 2.000 0.000
interstitial cystitis -1.200 0.000
Pick disease -1.400 0.000
progressive supranuclear palsy -1.100 0.022
ovarian cancer 1.300 0.000

Synonym

Accession Q9H3H1 A1A4X7 Q3T7B5 Q5QPK5 Q5QPK6 Q6IAC9 Q96FJ3 Q96L45 Q9NXT7
Symbols IPT
GRO1
IPPT
MOD5
hGRO1
IPTase

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (9)

PMID Text
25261850 In light of this additional nuclear role for Mod5 we discuss the proposed role of the human homologue of Mod5, TRIT1, as a tumor suppressor protein.[review]
24901367 patient cells bearing the p.Arg323Gln TRIT1 mutation are severely deficient in i6A37 in both cytosolic and mitochondrial tRNAs
24126054 TRIT1 may control the levels of some tRNAs as well as their specific activity.
23349019 One TRIT1 haplotype, CCGT, was associated with lymph node metastasis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20095854 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17145094 Observational study of gene-disease association. (HuGE Navigator)
17145094 The rare allele of TRIT1 Phe202Leu SNP was approximately seven-fold more frequent in Asian than in Caucasian subjects and three additional SNPs in the TRIT1 gene showed ethnic differences in allelic frequencies

AA Sequence

MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVYEGLDIITNKV      1 - 70
SAQEQRICRHHMISFVDPLVTNYTVVDFRNRATALIEDIFARDKIPIVVGGTNYYIESLLWKVLVNTKPQ     71 - 140
EMGTEKVIDRKVELEKEDGLVLHKRLSQVDPEMAAKLHPHDKRKVARSLQVFEETGISHSEFLHRQHTEE    141 - 210
GGGPLGGPLKFSNPCILWLHADQAVLDERLDKRVDDMLAAGLLEELRDFHRRYNQKNVSENSQDYQHGIF    211 - 280
QSIGFKEFHEYLITEGKCTLETSNQLLKKGIEALKQVTKRYARKQNRWVKNRFLSRPGPIVPPVYGLEVS    281 - 350
DVSKWEESVLEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSYHLCDLCDRIIIGDREWAAHIKSKSHL    351 - 420
NQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV                           421 - 467
//

Text Mined References (22)

PMID Year Title
25261850 2015 The cytoplasmic and nuclear populations of the eukaryote tRNA-isopentenyl transferase have distinct functions with implications in human cancer.
24901367 2014 Defective i6A37 modification of mitochondrial and cytosolic tRNAs results from pathogenic mutations in TRIT1 and its substrate tRNA.
24126054 2013 Human cells have a limited set of tRNA anticodon loop substrates of the tRNA isopentenyltransferase TRIT1 tumor suppressor.
23349019 2013 Association of polymorphisms and haplotype in the region of TRIT1, MYCL1 and MFSD2A with the risk and clinicopathological features of gastric cancer in a southeast Chinese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20095854 2010 Novel breast cancer risk alleles and interaction with ionizing radiation among U.S. radiologic technologists.
More...