Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $115,437.25
PubMed Score 8.37
PubTator Score 5.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.281 0.006
primary pancreatic ductal adenocarcinoma 1.398 0.001
group 3 medulloblastoma 1.100 0.001
ovarian cancer -1.700 0.000
pancreatic cancer 1.300 0.002

Synonym

Accession Q9H3F6 Q53HN2 Q59FV1 Q6PL47 Q96SU0 hBACURD3
Symbols BTBD28
ULRO61
MSTP028
hBACURD3

Gene

 Grant Application (1)

PDB

5FTA  

Gene RIF (8)

PMID Text
23977394 The gastrointestinal stromal tumor-specific transcription factor ETV1 may have no prognostic potential, whereas its downstream gene KCTD10 is associated with a favorable prognosis.
22810651 KCTD10 inhibited the transcriptional activities of nuclear factor kappa B (NF-kappaB) and activating protein-1 reporters
20570916 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19605566 For the SNPs KCTD10_i5642G-->C and MVK_S52NG-->A, homozygotes for the major alleles (G) had lower HDL-cholesterol concentrations than did carriers of the minor alleles (P = 0.005 and P = 0.019, respectively).
19605566 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19154347 binding of SP1 to the proximal promoter region stimulated the promoter activity and endogenous KCTD10 expression, whereas binding of AP-2alpha to this region showed opposite effects.
19125419 KCTD10 may be associated with DNA synthesis and cell proliferation

AA Sequence

MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTD      1 - 70
SEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKV     71 - 140
PVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDE    141 - 210
ICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAG    211 - 280
RSHHLDEDEERERIERVRRIHIKRPDDRAHLHQ                                         281 - 313
//

Text Mined References (22)

PMID Year Title
23977394 2013 Gene expression network analysis of ETV1 reveals KCTD10 as a novel prognostic biomarker in gastrointestinal stromal tumor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22810651 2012 TNFAIP1 interacts with KCTD10 to promote the degradation of KCTD10 proteins and inhibit the transcriptional activities of NF-?B and AP-1.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20570916 2010 Fine-mapping in African Americans of 8 recently discovered genetic loci for plasma lipids: the Jackson Heart Study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19782033 2009 Cullin mediates degradation of RhoA through evolutionarily conserved BTB adaptors to control actin cytoskeleton structure and cell movement.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19605566 2009 Novel variants at KCTD10, MVK, and MMAB genes interact with dietary carbohydrates to modulate HDL-cholesterol concentrations in the Genetics of Lipid Lowering Drugs and Diet Network Study.
More...