Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.47
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.300 2.9e-05
glioblastoma -1.100 2.0e-03
group 4 medulloblastoma -1.100 6.4e-05
invasive ductal carcinoma 1.100 3.4e-03
lung adenocarcinoma -1.400 2.1e-11
lung carcinoma -1.400 2.4e-15
medulloblastoma, large-cell -1.500 1.7e-04
non-small cell lung cancer -1.783 1.2e-24
ovarian cancer -1.100 4.0e-06
pituitary cancer -1.100 1.1e-07
sarcoidosis -1.400 2.2e-02
spina bifida -1.101 2.9e-02
tuberculosis -1.500 2.4e-06

Gene RIF (3)

AA Sequence

MDKALKEVFDYSYRDYILSWYGNLSRDEGQLYHLLLEDFWEIARQLHHRLSHVDVVKVVCNDVVRTLLTH      1 - 70
FCDLKAANARHEEQPRPFVLHACLRNSDDEVRFLQTCSRVLVFCLLPSKDVQSLSLRIMLAEILTTKVLK     71 - 140
PVVELLSNPDYINQMLLAQLAYREQMNEHHKRAYTYAPSYEDFIKLINSNSDVEFLKQLRYQIVVEIIQA    141 - 210
TTISSFPQLKRHKGKETAAMKADLLRARNMKRYINQLTVAKKQCEKRIRILGGPAYDQQEDGALDEGEGP    211 - 280
QSQKILQFEDILANTFYREHFGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEIS    281 - 350
VEKSLYKEIQQCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMG    351 - 420
PRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKER    421 - 490
TDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLH    491 - 560
RKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERLCQSEALYAFLSPSPDYLKV    561 - 630
IDVQGKKNSFSLSSFLERLPRDFFSHQEEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFK    631 - 700
WVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQR    701 - 770
AQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV    771 - 840
//

Text Mined References (9)

PMID Year Title