Property Summary

NCBI Gene PubMed Count 7
Grant Count 6
Funding $937,464.3
PubMed Score 2.66
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -1.100 0.002
medulloblastoma, large-cell -1.500 0.000
tuberculosis -1.700 0.000
non-small cell lung cancer -1.890 0.000
sarcoidosis -1.400 0.022
lung adenocarcinoma -1.400 0.000
adult high grade glioma -1.300 0.000
group 4 medulloblastoma -1.100 0.000
lung carcinoma -1.400 0.000
spina bifida -1.101 0.029
invasive ductal carcinoma 1.100 0.003
ovarian cancer 1.400 0.000
pituitary cancer -1.300 0.000

Gene RIF (3)

PMID Text
26214276 This study confirmed that SNX25 as genetic modifiers of age at onset of Alzheimer disease.
23518199 upregulation of SNX25 might be involved in the development of temporal lobe epilepsy.
21266196 SNX25 negatively regulates TGF-beta signaling by enhancing the receptor degradation through lysosome pathway.

AA Sequence

MDKALKEVFDYSYRDYILSWYGNLSRDEGQLYHLLLEDFWEIARQLHHRLSHVDVVKVVCNDVVRTLLTH      1 - 70
FCDLKAANARHEEQPRPFVLHACLRNSDDEVRFLQTCSRVLVFCLLPSKDVQSLSLRIMLAEILTTKVLK     71 - 140
PVVELLSNPDYINQMLLAQLAYREQMNEHHKRAYTYAPSYEDFIKLINSNSDVEFLKQLRYQIVVEIIQA    141 - 210
TTISSFPQLKRHKGKETAAMKADLLRARNMKRYINQLTVAKKQCEKRIRILGGPAYDQQEDGALDEGEGP    211 - 280
QSQKILQFEDILANTFYREHFGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEIS    281 - 350
VEKSLYKEIQQCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMG    351 - 420
PRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKER    421 - 490
TDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLH    491 - 560
RKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNLLSDERLCQSEALYAFLSPSPDYLKV    561 - 630
IDVQGKKNSFSLSSFLERLPRDFFSHQEEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFK    631 - 700
WVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQR    701 - 770
AQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV    771 - 840
//

Text Mined References (9)

PMID Year Title
26214276 2015 Genetic Modifiers of Age at Onset in Carriers of the G206A Mutation in PSEN1 With Familial Alzheimer Disease Among Caribbean Hispanics.
23518199 2013 Expression pattern of sorting Nexin 25 in temporal lobe epilepsy: a study on patients and pilocarpine-induced rats.
21266196 2011 SNX25 regulates TGF-? signaling by enhancing the receptor degradation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14975938 2004 Proteomic analysis of exosomes isolated from human malignant pleural effusions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461558 2002 Sorting out the cellular functions of sorting nexins.