Knowledge Summary

Patent

No data available

Synonym

Accession Q9H379
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPLASPIQHHEVTRGVAPSMALRDGVCRIPLSAEFTAQCTDSQAPQMKRAPRCCCLAVVAQCPHHCPVLG      1 - 70
CWSGCRCCCYCVFELHWLYCIQE                                                    71 - 93
//