Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.64
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Male infertility 206 3.767 1.9

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.196 7.4e-05
astrocytoma 1.400 4.3e-03
Duchenne muscular dystrophy 1.203 3.2e-07
lung adenocarcinoma 1.800 1.0e-10
lung cancer -3.000 4.8e-02
oligodendroglioma 1.300 4.1e-02
osteosarcoma 1.052 5.1e-03
ovarian cancer 1.800 2.5e-05
Pick disease 1.200 7.9e-06
spina bifida -1.001 3.5e-02

Gene RIF (4)

AA Sequence

MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSPAGPILSIRICRDLITSGSSNYAYVNFQHTKDAEHALD      1 - 70
TMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDKSINNKALYDTVSAFGNILSCNVVCDENGSKGY     71 - 140
GFVHFETHEAAERAIKKMNGMLLNGRKVFVGQFKSRKEREAELGARAKEFPNVYIKNFGEDMDDERLKDL    141 - 210
FGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRTF    211 - 280
EQMKQDRITRYQVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVATKPLYVALAQRKEERQAYLTNEYMQRMASVRAVPNQRAPPSGYFMTAVPQTQNHAAYYPPS    351 - 420
QIARLRPSPRWTAQGARPHPFQNKPSAIRPGAPRVPFSTMRPASSQVPRVMSTQRVANTSTQTVGPRPAA    421 - 490
AAAAAATPAVRTVPRYKYAAGVRNPQQHRNAQPQVTMQQLAVHVQGQETLTASRLASAPPQKQKQMLGER    491 - 560
LFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPT    561 - 630
V//

Text Mined References (11)

PMID Year Title