Knowledge Summary

Patent

No data available

 Compartment GO Term (0)

AA Sequence

MNKHNLRLVQLASELILIEIIPKLFLSQVTTISHIKREKIPPNHRKGILCMFPWQCVVYVFSNFVWLVIH      1 - 70
RFSNGFIQFLGEPYRLMTASGTHGRIKFMVDIPIIKNTQVLRIPVLKDPKMLSKKH                   71 - 126
//