Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.90
PubTator Score 10.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q9H347 Q9NRE0
Symbols TUP-1

Gene

PDB

1WX7   1YQB   2DAH  

  Ortholog (7)

Species Source
Chimp OMA Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
25776854 Functional analysis of the orthologous mouse gene.
11121057 Includes the identification of the ubiquilin 3 gene upstream of the beta-globin gene cluster and surrounding olfactory receptor genes.

AA Sequence

MAKGGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKIL      1 - 70
KDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPAASVPTQGPSPGSLPQPSSIYPADGPPAFSLGLLTGL     71 - 140
SRLGLAYRGFPDQPSSLMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPEIGHI    141 - 210
LNNPEIMRQTLEFLRNPAMMQEMIRSQDRVLSNLESIPGGYNVLCTMYTDIMDPMLNAVQEQFGGNPFAT    211 - 280
ATTDNATTTTSQPSRMENCDPLPNPWTSTHGGSGSRQGRQDGDQDAPDIRNRFPNFLGIIRLYDYLQQLH    281 - 350
ENPQSLGTYLQGTASALSQSQEPPPSVNRVPPSSPSSQEPGSGQPLPEESVAIKGRSSCPAFLRYPTENS    351 - 420
TGQGGDQDGAGKSSTGHSTNLPDLVSGLGDSANRVPFAPLSFSPTAAIPGIPEPPWLPSPAYPRSLRPDG    421 - 490
MNPAPQLQDEIQPQLPLLMHLQAAMANPRALQALRQIEQGLQVLATEAPRLLLWFMPCLAGTGSVAGGIE    491 - 560
SREDPLMSEDPLPNPPPEVFPALDSAELGFLSPPFLHMLQDLVSTNPQQLQPEAHFQVQLEQLRSMGFLN    561 - 630
REANLQALIATGGDVDAAVEKLRQS                                                 631 - 655
//

Text Mined References (9)

PMID Year Title
25776854 2015 Ubqln3, a testis-specific gene, is dispensable for embryonic development and spermatogenesis in mice.
24674348 2014 The ubiquilin gene family: evolutionary patterns and functional insights.
24012201 2013 Potential biomarkers of nonobstructive azoospermia identified in microarray gene expression analysis.
22941507 2012 Identification of the cancer/testis antigens AKAP3 and CTp11 by SEREX in hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10831842 2000 Molecular cloning, chromosome mapping and characterization of UBQLN3 a testis-specific gene that contains an ubiquitin-like domain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.