Property Summary

NCBI Gene PubMed Count 9
Grant Count 31
R01 Count 17
Funding $2,607,355.23
PubMed Score 6.90
PubTator Score 10.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Expression

Gene RIF (2)

PMID Text
25776854 Functional analysis of the orthologous mouse gene.
11121057 Includes the identification of the ubiquilin 3 gene upstream of the beta-globin gene cluster and surrounding olfactory receptor genes.

AA Sequence

MAKGGEALPQGSPAPVQDPHLIKVTVKTPKDKEDFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKIL      1 - 70
KDPDSLAQCGVRDGLTVHLVIKRQHRAMGNECPAASVPTQGPSPGSLPQPSSIYPADGPPAFSLGLLTGL     71 - 140
SRLGLAYRGFPDQPSSLMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPEIGHI    141 - 210
LNNPEIMRQTLEFLRNPAMMQEMIRSQDRVLSNLESIPGGYNVLCTMYTDIMDPMLNAVQEQFGGNPFAT    211 - 280
ATTDNATTTTSQPSRMENCDPLPNPWTSTHGGSGSRQGRQDGDQDAPDIRNRFPNFLGIIRLYDYLQQLH    281 - 350
ENPQSLGTYLQGTASALSQSQEPPPSVNRVPPSSPSSQEPGSGQPLPEESVAIKGRSSCPAFLRYPTENS    351 - 420
TGQGGDQDGAGKSSTGHSTNLPDLVSGLGDSANRVPFAPLSFSPTAAIPGIPEPPWLPSPAYPRSLRPDG    421 - 490
MNPAPQLQDEIQPQLPLLMHLQAAMANPRALQALRQIEQGLQVLATEAPRLLLWFMPCLAGTGSVAGGIE    491 - 560
SREDPLMSEDPLPNPPPEVFPALDSAELGFLSPPFLHMLQDLVSTNPQQLQPEAHFQVQLEQLRSMGFLN    561 - 630
REANLQALIATGGDVDAAVEKLRQS                                                 631 - 655
//

Text Mined References (9)

PMID Year Title
25776854 2015 Ubqln3, a testis-specific gene, is dispensable for embryonic development and spermatogenesis in mice.
24674348 2014 The ubiquilin gene family: evolutionary patterns and functional insights.
24012201 2013 Potential biomarkers of nonobstructive azoospermia identified in microarray gene expression analysis.
22941507 2012 Identification of the cancer/testis antigens AKAP3 and CTp11 by SEREX in hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10831842 2000 Molecular cloning, chromosome mapping and characterization of UBQLN3 a testis-specific gene that contains an ubiquitin-like domain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.