Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent (414)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 6.1e-06
medulloblastoma, large-cell 6241 1.4e-04
adult high grade glioma 3801 4.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

AA Sequence

MGLFNVTHPAFFLLTGIPGLESSHSWLSGPLCVMYAVALGGNTVILQAVRVEPSLHEPMYYFLSMLSFSD      1 - 70
VAISMATLPTVLRTFCLNARNITFDACLIQMFLIHFFSMMESGILLAMSFDRYVAICDPLRYATVLTTEV     71 - 140
IAAMGLGAAARSFITLFPLPFLIKRLPICRSNVLSHSYCLHPDMMRLACADISINSIYGLFVLVSTFGMD    141 - 210
LFFIFLSYVLILRSVMATASREERLKALNTCVSHILAVLAFYVPMIGVSTVHRFGKHVPCYIHVLMSNVY    211 - 280
LFVPPVLNPLIYSAKTKEIRRAIFRMFHHIKI                                          281 - 312
//

Text Mined References (5)

PMID Year Title