Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent (414)

TINX Plot

  Disease Relevance (3)

AA Sequence

MGLFNVTHPAFFLLTGIPGLESSHSWLSGPLCVMYAVALGGNTVILQAVRVEPSLHEPMYYFLSMLSFSD      1 - 70
VAISMATLPTVLRTFCLNARNITFDACLIQMFLIHFFSMMESGILLAMSFDRYVAICDPLRYATVLTTEV     71 - 140
IAAMGLGAAARSFITLFPLPFLIKRLPICRSNVLSHSYCLHPDMMRLACADISINSIYGLFVLVSTFGMD    141 - 210
LFFIFLSYVLILRSVMATASREERLKALNTCVSHILAVLAFYVPMIGVSTVHRFGKHVPCYIHVLMSNVY    211 - 280
LFVPPVLNPLIYSAKTKEIRRAIFRMFHHIKI                                          281 - 312
//

Text Mined References (5)

PMID Year Title
23406172 2013 Genetic determinants of haemolysis in sickle cell anaemia.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10220430 1999 Conservation of sequence and structure flanking the mouse and human beta-globin loci: the beta-globin genes are embedded within an array of odorant receptor genes.