Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent (196)

TINX Plot

  Disease Relevance (2)

AA Sequence

MLGLNGTPFQPATLQLTGIPGIQTGLTWVALIFCILYMISIVGNLSILTLVFWEPALHQPMYYFLSMLAL      1 - 70
NDLGVSFSTLPTVISTFCFNYNHVAFNACLVQMFFIHTFSFMESGILLAMSLDRFVAICYPLRYVTVLTH     71 - 140
NRILAMGLGILTKSFTTLFPFPFVVKRLPFCKGNVLHHSYCLHPDLMKVACGDIHVNNIYGLLVIIFTYG    141 - 210
MDSTFILLSYALILRAMLVIISQEQRLKALNTCMSHICAVLAFYVPIIAVSMIHRFWKSAPPVVHVMMSN    211 - 280
VYLFVPPMLNPIIYSVKTKEIRKGILKFFHKSQA                                        281 - 314
//

Text Mined References (6)

PMID Year Title
23406172 2013 Genetic determinants of haemolysis in sickle cell anaemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10220430 1999 Conservation of sequence and structure flanking the mouse and human beta-globin loci: the beta-globin genes are embedded within an array of odorant receptor genes.