Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent (196)

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0

AA Sequence

MLGLNGTPFQPATLQLTGIPGIQTGLTWVALIFCILYMISIVGNLSILTLVFWEPALHQPMYYFLSMLAL      1 - 70
NDLGVSFSTLPTVISTFCFNYNHVAFNACLVQMFFIHTFSFMESGILLAMSLDRFVAICYPLRYVTVLTH     71 - 140
NRILAMGLGILTKSFTTLFPFPFVVKRLPFCKGNVLHHSYCLHPDLMKVACGDIHVNNIYGLLVIIFTYG    141 - 210
MDSTFILLSYALILRAMLVIISQEQRLKALNTCMSHICAVLAFYVPIIAVSMIHRFWKSAPPVVHVMMSN    211 - 280
VYLFVPPMLNPIIYSVKTKEIRKGILKFFHKSQA                                        281 - 314
//

Text Mined References (6)

PMID Year Title