Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.95
PubTator Score 1.25

Knowledge Summary

Patent (208)


  Disease Sources (2)

Disease Target Count Z-score Confidence
Thalassemia 46 3.035 1.5
Disease Target Count
Sickle Cell Anemia 54


Accession Q9H339 B2RN59
Symbols OR11-37


  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (1)

20018918 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

FPPLMNPITYSVKTKQIQNAILHLFTTHRIGT                                          281 - 312

Text Mined References (7)

PMID Year Title
20018918 2010 Fetal hemoglobin in sickle cell anemia: genome-wide association studies suggest a regulatory region in the 5' olfactory receptor gene cluster.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10220430 1999 Conservation of sequence and structure flanking the mouse and human beta-globin loci: the beta-globin genes are embedded within an array of odorant receptor genes.