Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.95
PubTator Score 1.25

Knowledge Summary

Patent (208)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Thalassemia 53 3.047 1.5
Disease Target Count
Sickle Cell Anemia 53

Gene RIF (1)

AA Sequence

MSSSGSSHPFLLTGFPGLEEAHHWISVFFLFMYISILFGNGTLLLLIKEDHNLHEPMYFFLAMLAATDLG      1 - 70
LALTTMPTVLGVLWLDHREIGSAACFSQAYFIHSLSFLESGILLAMAYDRFIAICNPLRYTSVLTNTRVV     71 - 140
KIGLGVLMRGFVSVVPPIRPLYFFLYCHSHVLSHAFCLHQDVIKLACADTTFNRLYPAVLVVFIFVLDYL    141 - 210
IIFISYVLILKTVLSIASREERAKALITCVSHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLIMSYAYFL    211 - 280
FPPLMNPITYSVKTKQIQNAILHLFTTHRIGT                                          281 - 312
//

Text Mined References (7)

PMID Year Title