Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.05
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 2.23997574870005E-23
glioblastoma multiforme 347 2.44779733195158E-22
oligodendroglioma 2849 1.95668020720555E-14
breast carcinoma 1614 2.7435187345687E-10
Duchenne muscular dystrophy 602 1.05269016433106E-9
Breast cancer 3099 2.89356006650511E-9
pilocytic astrocytoma 3086 1.56395299944728E-8
psoriasis 6685 1.28443250774937E-7
cystic fibrosis 1670 3.02702988193586E-7
atypical teratoid/rhabdoid tumor 1095 1.90648230158565E-5
ovarian cancer 8492 3.69148421781732E-5
non-small cell lung cancer 2798 1.1083811210202E-4
adult high grade glioma 2148 2.97902783548821E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00173975235824184
primary pancreatic ductal adenocarcinoma 1271 0.00371123094935464
pancreatic cancer 2300 0.00772680235593173
group 4 medulloblastoma 1875 0.00955783583122173
medulloblastoma, large-cell 6234 0.0143157313227486
ependymoma 2514 0.026939111476649
subependymal giant cell astrocytoma 2287 0.0315726600882239

Expression

  Differential Expression (20)

Synonym

Accession Q9H336 B2RA60 B7Z929
Symbols CRISP10
LCRISP1
CRISP-10

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
21254358 These novel findings suggest that CRISPLD1 plays a role in Nonsyndromic cleft lip and palate (NSCLP) through the interaction with CRISPLD2 and folate pathway genes.

AA Sequence

MKCTAREWLRVTTVLFMARAIPAMVVPNATLLEKLLEKYMDEDGEWWIAKQRGKRAITDNDMQSILDLHN      1 - 70
KLRSQVYPTASNMEYMTWDVELERSAESWAESCLWEHGPASLLPSIGQNLGAHWGRYRPPTFHVQSWYDE     71 - 140
VKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWATSNRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKG    141 - 210
NWWGHAPYKHGRPCSACPPSFGGGCRENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSR    211 - 280
NEVISAQQMSQIVSCEVRLRDQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNDG    281 - 350
GWVDITRQGRKHYFIKSNRNGIQTIGKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPRVYCPR    351 - 420
NCMQANPHYARVIGTRVYSDLSSICRAAVHAGVVRNHGGYVDVMPVDKRKTYIASFQNGIFSESLQNPPG    421 - 490
GKAFRVFAVV                                                                491 - 500
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21254358 2011 Nonsyndromic cleft lip and palate: CRISPLD genes and the folate gene pathway connection.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.