Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.25
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 2.400 3.0e-04
astrocytoma 2.700 2.2e-23
Astrocytoma, Pilocytic 2.700 1.5e-08
atypical teratoid / rhabdoid tumor 1.800 1.9e-03
autosomal dominant Emery-Dreifuss muscul... 1.603 1.7e-03
Breast cancer 3.500 3.8e-02
breast carcinoma -1.300 2.7e-10
cystic fibrosis 3.818 3.0e-07
Duchenne muscular dystrophy 1.770 1.1e-09
ependymoma 2.700 2.7e-02
glioblastoma 1.800 8.0e-05
group 4 medulloblastoma -1.400 9.6e-03
medulloblastoma, large-cell -1.900 1.4e-02
non-small cell lung cancer 1.279 1.1e-04
oligodendroglioma 2.500 2.0e-14
ovarian cancer -3.500 3.7e-05
pancreatic cancer 1.300 7.7e-03
primary pancreatic ductal adenocarcinoma 1.664 3.7e-03
psoriasis -1.500 1.3e-07
subependymal giant cell astrocytoma 2.434 3.2e-02

Synonym

Accession Q9H336 B2RA60 B7Z929
Symbols CRISP10
LCRISP1
CRISP-10

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MKCTAREWLRVTTVLFMARAIPAMVVPNATLLEKLLEKYMDEDGEWWIAKQRGKRAITDNDMQSILDLHN      1 - 70
KLRSQVYPTASNMEYMTWDVELERSAESWAESCLWEHGPASLLPSIGQNLGAHWGRYRPPTFHVQSWYDE     71 - 140
VKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWATSNRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKG    141 - 210
NWWGHAPYKHGRPCSACPPSFGGGCRENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSR    211 - 280
NEVISAQQMSQIVSCEVRLRDQCKGTTCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNDG    281 - 350
GWVDITRQGRKHYFIKSNRNGIQTIGKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPRVYCPR    351 - 420
NCMQANPHYARVIGTRVYSDLSSICRAAVHAGVVRNHGGYVDVMPVDKRKTYIASFQNGIFSESLQNPPG    421 - 490
GKAFRVFAVV                                                                491 - 500
//

Text Mined References (10)

PMID Year Title