Property Summary

NCBI Gene PubMed Count 119
Grant Count 68
R01 Count 45
Funding $11,202,523.43
PubMed Score 190.86
PubTator Score 286.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H334 A3QVP8 B3KV70 G5E9V8 Q8NAN6 Q9BSG9 Q9H332 Q9H333 Q9P0R1
Symbols MFH
QRF1
12CC4
hFKH1B
HSPC215

Gene

PDB

2KIU  

 GO Component (2)

Gene RIF (97)

PMID Text
26898077 FOXP1 is present in normal cells of erythroid and myeloid linages and may have a possible role in development of all hematopoetic cells as well as possible involvement in neoplasm development of myeloid disorders.
26854715 Authors identified forkhead box protein P1 (FOXP1) as a direct target of miR-504 using microarray analysis and a luciferase assay.
26787899 Cell-line derived FOXP1 target genes that were highly correlated with FOXP1 expression in primary DLBCL accurately segregated the corresponding clinical subtypes of a large cohort of primary DLBCL isolates
26729899 S1PR2 is repressed by FOXP1 in activated B-cell and germinal center B-cell DLBCL cell lines with aberrantly high FOXP1 levels; S1PR2 expression is further inversely correlated with FOXP1 expression in 3 DLBCL patient cohorts.
26500140 FOXP1 represents a novel regulator of genes targeted by the class II MHC transactivator CIITA and CD74.
26494785 integral role for FoxP1 in regulating signaling pathways vulnerable in autism and the specific regulation of striatal pathways important for vocal communication
26489674 Studied the expression of FOXP1 in colorectal cancer and its potential associations with outcome in colorectal cancer.
26460480 FOXP1 - novel candidate genes validated in a large case-control sample of schizophrenia.
26383589 we provide supportive evidence that genetic variants at FOXP1, BARX1, and FOXF1 confer risk for the development of EAC.
26367773 FOXP1, TP53INP1, TNFAIP3, and TUSC2 were identified as miR-19a targets.
More...

AA Sequence

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLL      1 - 70
QQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQ     71 - 140
QQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPG    141 - 210
QPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQ    211 - 280
LSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQ    281 - 350
LELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG    351 - 420
PSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNE    421 - 490
IYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQ    491 - 560
SSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAV    561 - 630
HPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME                           631 - 677
//

Text Mined References (125)

PMID Year Title
26898077 2015 FOXP1 Expression in Normal and Neoplastic Erythroid and Myeloid Cells.
26854715 2016 A tumor-suppressive microRNA, miR-504, inhibits cell proliferation and promotes apoptosis by targeting FOXP1 in human glioma.
26787899 2016 Subtype-specific addiction of the activated B-cell subset of diffuse large B-cell lymphoma to FOXP1.
26729899 2016 The hematopoietic oncoprotein FOXP1 promotes tumor cell survival in diffuse large B-cell lymphoma by repressing S1PR2 signaling.
26647308 2016 Identification and functional characterization of de novo FOXP1 variants provides novel insights into the etiology of neurodevelopmental disorder.
26500140 2016 FOXP1 suppresses immune response signatures and MHC class II expression in activated B-cell-like diffuse large B-cell lymphomas.
26494785 2015 FoxP1 orchestration of ASD-relevant signaling pathways in the striatum.
26489674 2015 Expression of FOXP1 and Colorectal Cancer Prognosis.
26460480 2015 Expression analysis in a rat psychosis model identifies novel candidate genes validated in a large case-control sample of schizophrenia.
26383589 2015 Supportive evidence for FOXP1, BARX1, and FOXF1 as genetic risk loci for the development of esophageal adenocarcinoma.
More...