Property Summary

NCBI Gene PubMed Count 136
PubMed Score 210.55
PubTator Score 286.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
MALT lymphoma 6

Expression

  Differential Expression (26)

 GO Component (2)

Gene RIF (112)

AA Sequence

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLL      1 - 70
QQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQ     71 - 140
QQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLAFQQQLLQMQQLQQQHLLSLQRQGLLTIQPG    141 - 210
QPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQ    211 - 280
LSVHTPKRESLSHEEHPHSHPLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQ    281 - 350
LELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG    351 - 420
PSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILESPEKQLTLNE    421 - 490
IYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEFQKRRPQKISGNPSLIKNMQ    491 - 560
SSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLASAIREELNGAMEHTNSNESDSSPGRSPMQAV    561 - 630
HPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDME                           631 - 677
//

Text Mined References (143)

PMID Year Title