Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.60
PubTator Score 66.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia -1.300 4.8e-02
adult high grade glioma -1.200 8.6e-06
atypical teratoid / rhabdoid tumor -1.200 3.2e-05
intraductal papillary-mucinous adenoma (... 1.100 4.8e-02
invasive ductal carcinoma -1.500 3.8e-03
lung adenocarcinoma -1.500 1.7e-12
medulloblastoma, large-cell -1.100 6.6e-04
non-small cell lung cancer -1.041 2.6e-11
ovarian cancer -2.400 2.5e-08

Gene RIF (1)

AA Sequence

MADGGGPKDAPSLRSSPGPAPRVPRAVGPSGGGGETPRTAALALRFDKPIKQAFYNTGAVLFVCLCCGAA      1 - 70
VLVYFILEAFLRPLLWAVLCGTFLHPFKSSLTRLGRHWLQRLHRAHTPIVLAALLLPLCFVDYGVEALGE     71 - 140
QALRRRRLLLLLGAGGPLLYGLYCLGSYLGVQVLLVHAATLICRGLDYFSSLWIWTLVVGYVLTVSFKWN    141 - 210
ASTERYLRAVSIPVWIILLFHLASLAGSWRIPVFLVIVFLMSVGTLYEKQNGKESSGAELPGQVISMAAS    211 - 280
TLANLAISITGYESSSEDQPSTQPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGRRRPEIGTFLRKKK    281 - 350
TSDIYFVSLVWAIVVMQIWLNLWIVQLLPVPIAVWILKKLVIHFGVVDFLEKRYHVWWGIIESFLKERQG    351 - 420
ALAPWPIVGLGKFLLKVDSKLWHWLNKKMIIWLEKMLDKIISIFIIFLLVIGTLLLALLLTAKVHQESVH    421 - 490
MIEVTSNLINETLANHPEWANWLPEAQVVQRALNSAANNVYQYGREWITHKLHKILGDKVNNTAVIEKQV    491 - 560
LELWDRLYHSWFVKNVTHSGRHKGQKLHVSRQNSWLGDILDWQDIVSFVHENIETFLSILESLWIVMSRN    561 - 630
VSLLFTTVTTLLTILFYSGTALLNFVLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIG    631 - 700
QSVEEAIRGVFDASLKMAGFYGLYTWLTHTMFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLDLWLTQ    701 - 770
GLGCKAILLLIFHLLPTYFVDTAIYSDISGGGHPYLTGLAVAGGAYYLGLEGAIIGPILLCILVVASNIY    771 - 840
SAMLVSPTNSVPTPNQTPWPAQPQRTFRDISERSEIFSKVDVVSSAVIFLRKFKFDSEFSSAVAFCPSSC    841 - 910
A//

Text Mined References (21)

PMID Year Title