Property Summary

NCBI Gene PubMed Count 10
PubMed Score 158.41
PubTator Score 66.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
non-small cell lung cancer 2798 2.36633795945566E-15
ovarian cancer 8492 2.95277739994846E-13
lung adenocarcinoma 2714 1.70031633784462E-12
adult high grade glioma 2148 8.6201739190448E-6
atypical teratoid / rhabdoid tumor 4369 3.20395848833837E-5
medulloblastoma, large-cell 6234 8.3638964854103E-5
invasive ductal carcinoma 2950 0.00375501450926421
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0476879751536255
acute myeloid leukemia 785 0.0478386828000778
Disease Target Count Z-score Confidence
Spermatocele 2 3.867 1.9

Expression

Synonym

Accession Q9H330 B4DSW7 Q5JTQ5 Q5SS43 Q6ZME3 Q8NDJ5 Q96CG6
Symbols CG2
CG-2
C9orf5

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
23382809 we detected five SNPs in the first two genes/loci - BCL9 and C9orf5 - strongly associated with negative symptoms of schizophrenia

AA Sequence

MADGGGPKDAPSLRSSPGPAPRVPRAVGPSGGGGETPRTAALALRFDKPIKQAFYNTGAVLFVCLCCGAA      1 - 70
VLVYFILEAFLRPLLWAVLCGTFLHPFKSSLTRLGRHWLQRLHRAHTPIVLAALLLPLCFVDYGVEALGE     71 - 140
QALRRRRLLLLLGAGGPLLYGLYCLGSYLGVQVLLVHAATLICRGLDYFSSLWIWTLVVGYVLTVSFKWN    141 - 210
ASTERYLRAVSIPVWIILLFHLASLAGSWRIPVFLVIVFLMSVGTLYEKQNGKESSGAELPGQVISMAAS    211 - 280
TLANLAISITGYESSSEDQPSTQPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGRRRPEIGTFLRKKK    281 - 350
TSDIYFVSLVWAIVVMQIWLNLWIVQLLPVPIAVWILKKLVIHFGVVDFLEKRYHVWWGIIESFLKERQG    351 - 420
ALAPWPIVGLGKFLLKVDSKLWHWLNKKMIIWLEKMLDKIISIFIIFLLVIGTLLLALLLTAKVHQESVH    421 - 490
MIEVTSNLINETLANHPEWANWLPEAQVVQRALNSAANNVYQYGREWITHKLHKILGDKVNNTAVIEKQV    491 - 560
LELWDRLYHSWFVKNVTHSGRHKGQKLHVSRQNSWLGDILDWQDIVSFVHENIETFLSILESLWIVMSRN    561 - 630
VSLLFTTVTTLLTILFYSGTALLNFVLSLIIFLTTLFYLLSSSDEYYKPVKWVISLTPLSQPGPSSNIIG    631 - 700
QSVEEAIRGVFDASLKMAGFYGLYTWLTHTMFGINIVFIPSALAAILGAVPFLGTYWAAVPAVLDLWLTQ    701 - 770
GLGCKAILLLIFHLLPTYFVDTAIYSDISGGGHPYLTGLAVAGGAYYLGLEGAIIGPILLCILVVASNIY    771 - 840
SAMLVSPTNSVPTPNQTPWPAQPQRTFRDISERSEIFSKVDVVSSAVIFLRKFKFDSEFSSAVAFCPSSC    841 - 910
A//

Text Mined References (21)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382809 2013 BCL9 and C9orf5 are associated with negative symptoms in schizophrenia: meta-analysis of two genome-wide association studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
21130836 2011 Whole genome association scan for genetic polymorphisms influencing information processing speed.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
More...