Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.48
PubTator Score 13.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active ulcerative colitis -1.116 2.2e-02
adult high grade glioma -2.400 2.6e-05
aldosterone-producing adenoma -1.116 1.7e-02
astrocytic glioma -1.900 2.9e-03
atypical teratoid / rhabdoid tumor 1.700 2.1e-04
cutaneous lupus erythematosus -1.100 2.5e-02
ductal carcinoma in situ -1.300 4.1e-03
ependymoma -2.100 3.6e-03
esophageal adenocarcinoma 1.300 2.2e-02
glioblastoma -1.800 7.2e-06
group 3 medulloblastoma 1.300 1.6e-04
interstitial cystitis -2.000 1.6e-02
intraductal papillary-mucinous adenoma (... -1.600 2.2e-02
invasive ductal carcinoma -1.100 2.4e-02
lung carcinoma 1.500 6.7e-20
medulloblastoma, large-cell 1.400 2.4e-03
non-small cell lung cancer 1.036 1.6e-07
oligodendroglioma -1.800 6.8e-03
osteosarcoma -1.459 4.2e-02
ovarian cancer -1.200 1.2e-03
pancreatic cancer -1.300 5.7e-03
pancreatic ductal adenocarcinoma liver m... -2.024 9.3e-03
periodontitis -1.300 2.6e-29
primitive neuroectodermal tumor 1.500 3.3e-02
psoriasis -1.200 7.4e-10
spina bifida -1.704 4.1e-02
subependymal giant cell astrocytoma -2.376 9.2e-03

Gene RIF (4)

AA Sequence

MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSALPAAPGGSVFPAGGGPLLTGG      1 - 70
AAVHISAAGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWL     71 - 140
DHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQ    141 - 210
AELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVR    211 - 280
GRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSART    281 - 350
CKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSR    351 - 420
RHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVSYPLPSPVLSSSDRLPFGIEE    421 - 490
NGGTPFLTAASGRHHHQHQHQHQHQHHSNYSLSLTLENKEGPLRSPNSSSKSLTKLSPGTPALFSEAAAH    491 - 560
LKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKE    561 - 630
ESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTS    631 - 700
TTTNTTTAATQVSVPLPSPKVQNVSSPHKSEGKGLLSPGAKSPSDRGGAFTLEPGDLLMDFTEATPLAEP    701 - 770
ASNPHCAHSRCSPPLSLPMKEETTGVCMYPPIKTRLIKTFPVDTMNPFPDTFTTGPQFTADFRDSKLQCC    771 - 840
PGPTSPLIPAATLRPLTETVSTVQTIYTTRKPVSLAASAETLRQELEREKMMKRLLMTEL              841 - 900
//

Text Mined References (10)

PMID Year Title