Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.56
PubTator Score 13.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Synonym

Accession Q9H329 Q5T4G5 Q5T4G6 Q9H328 Q9P2V3
Symbols CG1
EHM2

Gene

Gene RIF (4)

PMID Text
26217016 CRB3A recruits p114RhoGEF and its activator Ehm2 to the cell periphery using both functional motifs of its cytoplasmic tail and increases RhoA activation levels.
23664528 Ehm2 may be an important player in the wound healing process; Ehm2 knockdown downregulates the expression of NWasp, through which it may have its effect on cellular migration
23662806 (review) FERM domains are found in a wide variety of proteins, but in particular they constitute the major, and in some cases the only, recognized functional domain present in the FRMDs.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSALPAAPGGSVFPAGGGPLLTGG      1 - 70
AAVHISAAGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWL     71 - 140
DHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQ    141 - 210
AELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVR    211 - 280
GRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSART    281 - 350
CKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSR    351 - 420
RHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVSYPLPSPVLSSSDRLPFGIEE    421 - 490
NGGTPFLTAASGRHHHQHQHQHQHQHHSNYSLSLTLENKEGPLRSPNSSSKSLTKLSPGTPALFSEAAAH    491 - 560
LKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKE    561 - 630
ESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTS    631 - 700
TTTNTTTAATQVSVPLPSPKVQNVSSPHKSEGKGLLSPGAKSPSDRGGAFTLEPGDLLMDFTEATPLAEP    701 - 770
ASNPHCAHSRCSPPLSLPMKEETTGVCMYPPIKTRLIKTFPVDTMNPFPDTFTTGPQFTADFRDSKLQCC    771 - 840
PGPTSPLIPAATLRPLTETVSTVQTIYTTRKPVSLAASAETLRQELEREKMMKRLLMTEL              841 - 900
//

Text Mined References (10)

PMID Year Title
26217016 2015 CRB3A Controls the Morphology and Cohesion of Cancer Cells through Ehm2/p114RhoGEF-Dependent Signaling.
23664528 2013 Expressed in high metastatic cells (Ehm2) is a positive regulator of keratinocyte adhesion and motility: The implication for wound healing.
23662806 2013 The expanding family of FERM proteins.
22006950 2011 Lulu2 regulates the circumferential actomyosin tensile system in epithelial cells through p114RhoGEF.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14576147 2004 Androgen control of cell proliferation and cytoskeletal reorganization in human fibrosarcoma cells: role of RhoB signaling.
14521927 2003 Androgen regulation of the human FERM domain encoding gene EHM2 in a cell model of steroid-induced differentiation.
10783258 2000 Molecular cloning of a novel NF2/ERM/4.1 superfamily gene, ehm2, that is expressed in high-metastatic K1735 murine melanoma cells.
10603000 2000 Cloning, mapping, and expression of a novel brain-specific transcript in the familial dysautonomia candidate region on chromosome 9q31.