Property Summary

NCBI Gene PubMed Count 19
PubMed Score 20.88
PubTator Score 23.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.23054980647653E-11
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Brachydactyly 52 4.311 2.2
Glaucoma 135 4.057 2.0
Tracheal stenosis 18 3.881 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
juvenile dermatomyositis -1.116 0.000

Synonym

Accession Q9H324 M0QZE4 ADAM-TS 10
Symbols WMS
WMS1
ADAM-TS10
ADAMTS-10

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GWAS Trait (1)

Gene RIF (8)

PMID Text
23422823 These findings support the Gly661Arg mutation of ADAMTS10 as the likely cause of POAG in beagles.
21402694 ADAMTS10 participates in microfibril biogenesis rather than in fibrillin-1 turnover
19836009 Homozygous mutation in ADAMTS10 causes lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature.
19696795 Mutations in ADAMTS10 gene is not responsible for microspherophakia.
18567016 infer that folding of the complex C-terminal ancillary domain is the rate-limiting step in biosynthesis of ADAMTS10, and that it (but not catalytic domain) is sensitive to subtle changes in efficiency of signal peptide cleavage.
15368195 ADAMTS10 plays a major role in growth and in skin, lens, and heart development in humans.
15358598 Expression in human colonic cell lines.
15355968 ADAMTS10 is a functional metalloprotease as demonstrated by cleavage of alpha2-macroglobulin

AA Sequence

MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPPPRRQRRGTGA      1 - 70
TAESRLFYKVASPSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARPHCLYAGHLQGQASTSHVAIS     71 - 140
TCGGLHGLIVADEEEYLIEPLHGGPKGSRSPEESGPHVVYKRSSLRHPHLDTACGVRDEKPWKGRPWWLR    141 - 210
TLKPPPARPLGNETERGQPGLKRSVSRERYVETLVVADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSL    211 - 280
GSTVNILVTRLILLTEDQPTLEITHHAGKSLDSFCKWQKSIVNHSGHGNAIPENGVANHDTAVLITRYDI    281 - 350
CIYKNKPCGTLGLAPVGGMCERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLM    351 - 420
AAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCRFQHGVKSRQC    421 - 490
KYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFGSRPEGVDGAWGPWTPWGDCS    491 - 560
RTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCNTDDCPPGSQDFREVQCSEFDSIPFRGKFYKWKT    561 - 630
YRGGGVKACSLTCLAEGFNFYTERAAAVVDGTPCRPDTVDICVSGECKHVGCDRVLGSDLREDKCRVCGG    631 - 700
DGSACETIEGVFSPASPGAGYEDVVWIPKGSVHIFIQDLNLSLSHLALKGDQESLLLEGLPGTPQPHRLP    701 - 770
LAGTTFQLRQGPDQVQSLEALGPINASLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQ    771 - 840
CAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPDWVVGNWSLCSRSCDAGVRSRSVV    841 - 910
CQRRVSAAEEKALDDSACPQPRPPVLEACHGPTCPPEWAALDWSECTPSCGPGLRHRVVLCKSADHRATL    911 - 980
PPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGECSAQCGVGQRQRSVRCTSHTGQASHECTEALRPPTT    981 - 1050
QQCEAKCDSPTPGDGPEECKDVNKVAYCPLVLKFQFCSRAYFRQMCCKTCHGH                    1051 - 1103
//

Text Mined References (19)

PMID Year Title
23422823 2013 Screening ADAMTS10 in dog populations supports Gly661Arg as the glaucoma-causing variant in beagles.
23074332 2012 SuperTAG methylation-specific digital karyotyping reveals uremia-induced epigenetic dysregulation of atherosclerosis-related genes.
21402694 2011 ADAMTS10 protein interacts with fibrillin-1 and promotes its deposition in extracellular matrix of cultured fibroblasts.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19836009 2009 Homozygous mutations in ADAMTS10 and ADAMTS17 cause lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature.
19696795 2009 Clinical and genetic investigation of isolated microspherophakia in a consanguineous Tunisian family.
18567016 2008 Functional analysis of an ADAMTS10 signal peptide mutation in Weill-Marchesani syndrome demonstrates a long-range effect on secretion of the full-length enzyme.
18391951 2008 Many sequence variants affecting diversity of adult human height.
15368195 2004 ADAMTS10 mutations in autosomal recessive Weill-Marchesani syndrome.
15358598 2005 ADAM-15 inhibits wound healing in human intestinal epithelial cell monolayers.
More...