Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.44
PubTator Score 0.74

Knowledge Summary

Patent

No data available

AA Sequence

MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESA      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESEVEEPLSQESEVEEPLTVWMASFSPVSESTD      71 - 139
//

Text Mined References (7)

PMID Year Title
18076704 2008 Analysis of the VCX3A, VCX2 and VCX3B genes shows that VCX3A gene deletion is not sufficient to result in mental retardation in X-linked ichthyosis.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
10903929 2000 A member of a gene family on Xp22.3, VCX-A, is deleted in patients with X-linked nonspecific mental retardation.
10607842 2000 A human sex-chromosomal gene family expressed in male germ cells and encoding variably charged proteins.