Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.44
PubTator Score 0.74

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H322 A3KPB6 Q4V9T2 Q9P0H5
Symbols VCXB
VCX2R
VCX-2r

Gene

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESA      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESEVEEPLSQESEVEEPLTVWMASFSPVSESTD      71 - 139
//

Text Mined References (7)

PMID Year Title