Property Summary

NCBI Gene PubMed Count 10
Grant Count 9
R01 Count 4
Funding $6,836,722.34
PubMed Score 2.07
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.002

AA Sequence

MSPKPRASGPPAKAKEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEV     71 - 140
EEPLSQESQVEEPLSQESEVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEM    141 - 210
EEPLSQESQVEEPLSQESEMEEPLSQESEMEELPSV                                      211 - 246
//

Text Mined References (12)

PMID Year Title
19812318 2009 Modulation of neuritogenesis by a protein implicated in X-linked mental retardation.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
18076704 2008 Analysis of the VCX3A, VCX2 and VCX3B genes shows that VCX3A gene deletion is not sufficient to result in mental retardation in X-linked ichthyosis.
17342728 2008 A shared promoter region suggests a common ancestor for the human VCX/Y, SPANX, and CSAG gene families and the murine CYPT family.
16470742 2006 Molecular cytogenetic analysis of a familial interstitial deletion Xp22.2-22.3 with a highly variable phenotype in female carriers.
15888481 2005 Deletion of VCX-A due to NAHR plays a major role in the occurrence of mental retardation in patients with X-linked ichthyosis.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15008409 2003 Evolutionary dynamics of duplicated microsatellites shared by sex chromosomes.
12862317 2003 Expression and localization of VCX/Y proteins and their possible involvement in regulation of ribosome assembly during spermatogenesis.
More...