Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.07
PubTator Score 2.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.9e-03

AA Sequence

MSPKPRASGPPAKAKEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEV     71 - 140
EEPLSQESQVEEPLSQESEVEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEM    141 - 210
EEPLSQESQVEEPLSQESEMEEPLSQESEMEELPSV                                      211 - 246
//

Text Mined References (12)

PMID Year Title