Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $84,240
PubMed Score 29.97
PubTator Score 9.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24970476 Identified members of the VCX/Y gene family as novel CT antigens.
17342728 Human VCX/Y, SPANX, and CSAG2 gene families together with the murine SPANX gene and the CYPT family may share a common ancestor.

AA Sequence

MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESA      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQEAELEEPLSQESEVEEPLSQESQVEEPLSQESEV     71 - 140
EEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV        141 - 206
//

Text Mined References (8)

PMID Year Title
24970476 2014 A search for novel cancer/testis antigens in lung cancer identifies VCX/Y genes, expanding the repertoire of potential immunotherapeutic targets.
17342728 2008 A shared promoter region suggests a common ancestor for the human VCX/Y, SPANX, and CSAG gene families and the murine CYPT family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12862317 2003 Expression and localization of VCX/Y proteins and their possible involvement in regulation of ribosome assembly during spermatogenesis.
12826317 2003 Genetic alterations of lung adenocarcinoma in relation to smoking and ethnicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10903929 2000 A member of a gene family on Xp22.3, VCX-A, is deleted in patients with X-linked nonspecific mental retardation.
10607842 2000 A human sex-chromosomal gene family expressed in male germ cells and encoding variably charged proteins.