Property Summary

NCBI Gene PubMed Count 7
PubMed Score 31.61
PubTator Score 9.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H320 A0JNS5 Q4V774 Q9P0H3
Symbols VCX1
VCXB1
VCX-B1
VCX10R
VCX-10r

Gene

VCX

Gene RIF (2)

AA Sequence

MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESA      1 - 70
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQEAELEEPLSQESEVEEPLSQESQVEEPLSQESEV     71 - 140
EEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV        141 - 206
//

Text Mined References (8)

PMID Year Title