Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 9.18

Knowledge Summary

Patent (285)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.500 3.8e-07
breast carcinoma -2.900 3.3e-06
group 3 medulloblastoma -3.600 4.3e-08
intraductal papillary-mucinous adenoma (... -1.100 9.0e-03
medulloblastoma, large-cell -4.500 1.2e-07
psoriasis -1.100 3.0e-03
subependymal giant cell astrocytoma -3.035 6.5e-03

Gene RIF (4)

AA Sequence

MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALAGLGLGLSLIFIAVYLIRFC      1 - 70
CCRPPEPPGSKIPSPGGGCVTWSCIVALLAGCTGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDHLV     71 - 140
LETVERLGEAVRTELTTLEEVLEPRTELVAAARGARRQAEAAAQQLQGLAFWQGVPLSPLQVAENVSFVE    141 - 210
EYRWLAYVLLLLLELLVCLFTLLGLAKQSKWLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDP    211 - 280
YVLNLTQEETGLSSDILSYYLLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSL    281 - 350
EETLNVTEGNFHQLVALLHCRSLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALF    351 - 420
PPSDDYDDTDDDDPFNPQESKRFVQWQSSI                                            421 - 450
//

Text Mined References (14)

PMID Year Title