Property Summary

NCBI Gene PubMed Count 31
PubMed Score 46.43
PubTator Score 28.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 5.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.0
Disease Target Count Z-score Confidence
Metabolic acidosis 90 4.709 2.4

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.172 5.1e-05

Gene RIF (13)

AA Sequence

MAGSPSRAAGRRLQLPLLCLFLQGATAVLFAVFVRYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAM      1 - 70
VFVGFGFLMVFLQRYGFSSVGFTFLLAAFALQWSTLVQGFLHSFHGGHIHVGVESMINADFCAGAVLISF     71 - 140
GAVLGKTGPTQLLLMALLEVVLFGINEFVLLHLLGVRDAGGSMTIHTFGAYFGLVLSRVLYRPQLEKSKH    141 - 210
RQGSVYHSDLFAMIGTIFLWIFWPSFNAALTALGAGQHRTALNTYYSLAASTLGTFALSALVGEDGRLDM    211 - 280
VHIQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESKFKVQDTCGVHNLHGMPGV    281 - 350
LGALLGVLVAGLATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLGGLLLKLPFL    351 - 420
DSPPRLPALRGPSSLAGAWRA                                                     421 - 441
//

Text Mined References (31)

PMID Year Title