Property Summary

NCBI Gene PubMed Count 30
Grant Count 10
R01 Count 8
Funding $1,125,048.1
PubMed Score 43.32
PubTator Score 28.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Metabolic acidosis 49 4.633 2.3
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.172 0.000

Gene RIF (13)

PMID Text
26029888 RHBG expression as a direct target of beta-catenin regulation.
25616663 Kidney AE1 actually associates with epithelial ankyrin-G and renal ammonium transporter RhBG, which also binds ankyrin-G.
24647713 Rh B Glycoprotein (Rhbg) and Rh C Glycoprotein (Rhcg) are identified as ammonia transporters. They are expressed in specific cell populations and membrane domains in distal renal epithelial cells, where they facilitate ammonia secretion.
24077989 RhAG, RhBG and RhCG-exhibit significant permeability to NH3 and show for the first time that RhBG and RhCG can conduct CO2.
23324176 human kidney expresses basolateral RhBG protein in connecting segment, type A intercalated cells, and non-A, non-B cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19429772 Rhbg and Rhcg may contribute to bronchial epithelial cell ammonia metabolism and suggest that they do not contribute to pulmonary carbon dioxide transport.
19357182 This study concludes that under normal conditions, RhCG is the major putative ammonia transporter expressed in the human kidney and RhBG is not expressed at detectable levels.
18635543 Phosphorylation and ankyrin-G binding of the C-terminal domain regulate targeting and function of the ammonium transporter RhBG
More...

AA Sequence

MAGSPSRAAGRRLQLPLLCLFLQGATAVLFAVFVRYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAM      1 - 70
VFVGFGFLMVFLQRYGFSSVGFTFLLAAFALQWSTLVQGFLHSFHGGHIHVGVESMINADFCAGAVLISF     71 - 140
GAVLGKTGPTQLLLMALLEVVLFGINEFVLLHLLGVRDAGGSMTIHTFGAYFGLVLSRVLYRPQLEKSKH    141 - 210
RQGSVYHSDLFAMIGTIFLWIFWPSFNAALTALGAGQHRTALNTYYSLAASTLGTFALSALVGEDGRLDM    211 - 280
VHIQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESKFKVQDTCGVHNLHGMPGV    281 - 350
LGALLGVLVAGLATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLGGLLLKLPFL    351 - 420
DSPPRLPALRGPSSLAGAWRA                                                     421 - 441
//

Text Mined References (30)

PMID Year Title
26029888 2015 Wnt/?-Catenin Signaling Regulates the Expression of the Ammonium Permease Gene RHBG in Human Cancer Cells.
25616663 2015 Evidence of a structural and functional ammonium transporter RhBG·anion exchanger 1·ankyrin-G complex in kidney epithelial cells.
24647713 2014 Ammonia transport in the kidney by Rhesus glycoproteins.
24077989 2013 Relative CO?/NH? permeabilities of human RhAG, RhBG and RhCG.
23324176 2013 Expression of the ammonia transporter family member, Rh B Glycoprotein, in the human kidney.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20539225 2010 Molecular physiology of the Rh ammonia transport proteins.
19953292 2010 The Rh protein family: gene evolution, membrane biology, and disease association.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...