Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.10
PubTator Score 2.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Atopic dermatitis 952 5.9e-05
psoriasis 6694 4.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis -1.800 5.9e-05
psoriasis -1.300 4.6e-04

Gene RIF (5)

AA Sequence

MKRLLLLFLFFITFSSAFPLVRMTENEENMQLAQAYLNQFYSLEIEGNHLVQSKNRSLIDDKIREMQAFF      1 - 70
GLTVTGKLDSNTLEIMKTPRCGVPDVGQYGYTLPGWRKYNLTYRIINYTPDMARAAVDEAIQEGLEVWSK     71 - 140
VTPLKFTKISKGIADIMIAFRTRVHGRCPRYFDGPLGVLGHAFPPGPGLGGDTHFDEDENWTKDGAGFNL    141 - 210
FLVAAHEFGHALGLSHSNDQTALMFPNYVSLDPRKYPLSQDDINGIQSIYGGLPKEPAKPKEPTIPHACD    211 - 280
PDLTFDAITTFRREVMFFKGRHLWRIYYDITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWM    281 - 350
IRGYAVLPDYPKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVVKHFPG    351 - 420
ISIRVDAAFQYKGFFFFSRGSKQFEYDIKTKNITRIMRTNTWFQCKEPKNSSFGFDINKEKAHSGGIKIL    421 - 490
YHKSLSLFIFGIVHLLKNTSIYQ                                                   491 - 513
//

Text Mined References (10)

PMID Year Title